Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting sold for 82 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 17oz50ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Smart Clinical Repair Overnight sold at 80 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Ulta.com.
Smart Clinical Repair Overnight Recovery Face Cream Mask SMRT CLNCL RPR VRNT RCVRY CRM MSKBenefitsHelps restore your skin barrier which is naturally weaker at night A weaker barrier makes skin more susceptible to external factors which makes it more prone to sensitivityOptimizes skins natural nightly repair process visibly reducing lines and wrinkles and soothing the look of sensitivityPlumps and reduces fine dry lines overnightVisibly corrects wrinkles smooths skin and boosts radiance over timeDelivers rich deep hydrationDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeKey IngredientsAdenosine Naturally occurring nocturnal biomolecule helps visibly quell irritation turning down or soothing sensitivityPeptides Help boost skins strength for a smoother appearance Formula includes neuropeptide and signaling peptides Palmitoyl tripeptide1 Acetyl hexapeptide8 Palmitoyl tetrapeptide712 hyaluronic acid solution Helps hydrate to visibly smooth fine dry linesResearch ResultsOvernightSkin is hydrated feels soothed and skin barrier is strengthenedIn 1 weekCrows feet forehead lines nasolabial folds and neck lines are visibly reducedIn 2 weeks97 show reduced facial lines92 say skin looks healthier94 say skin looks smoother92 say skin looks radiantClinical testing on 33 women after using the product for 1 weekFacial lines refers to crows feet lines Clinical testing on 33 women after using the product for 2 weeksConsumer testing on 132 women after using the product for 2 weeks Smart Clinical Repair Overnight Recovery Face Cream Mask
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333232392
Discover information, advice, and prices for Clinique 1 7oz Smart Clinical sold for 69.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Clinique.
Clinique Smart Clinical Md MultiDimensional Age Transformer Duo Resculpt Revolumize 17oz Active ingredients Resculpt WaterAquaEau Glycerin Caprylyl Methicone Butylene Glycol Alcohol Denat Dimethicone Isododecane Peg10 Dimethicone Dipropylene Glycol Prunus Amygdalus Dulcis Sweet Almond Seed Extract Cucumis Melo Melon Fruit Extract Persea Gratissima Avocado Oil Saccharomyces Lysate Extract Acetyl Glucosamine Porphyridium Cruentum Extract Dipeptide Diaminobutyroyl Benzylamide Diacetate Acetyl Hexapeptide8 Palmitoyl Tetrapeptide7 Acetyl Octapeptide3 Cholesterol Decarboxy Carnosine Hcl Acetyl Carnitine Hcl Caffeine Creatine Sigesbeckia Orientalis St PaulS Wort Extract Palmitoyl Tripeptide1 Polygonum Cuspidatum Root Extract Centella Asiatica Hydrocotyl Extract Glycine Soja Soybean Protein Ergothioneine Propylene Glycol Dicaprylate Peg150 Lauryl Peg9 Polydimethylsiloxyethyl Dimethicone Jojoba Esters Whey ProteinLactis ProteinProteine Du PetitLait Adenosine Phosphate Tocopheryl Acetate Lactic Acid Yeast ExtractFaexExtrait De Levure Linoleic Acid Sodium Hyaluronate Phytantriol Glycine Soja Soybean Seed Extract Disteardimonium Hectorite Propylene Carbonate Menthanediol Hydroxypropyl Methylcellulose Pullulan Polyquaternium51 Sodium Hydroxide Calcium Chloride Carbomer Sea Whip Extract Polysorbate 20 Caprylyl Glycol Tetrahexyldecyl Ascorbate Citric Acid Potassium Sulfate Sodium Hexametaphosphate Sodium Citrate Potassium Sorbate Sodium Benzoate Phenoxyethanol Revolumize WaterAquaEau Butylene Glycol Butyrospermum Parkii Shea Butter Cetearyl Alcohol Hydrogenated Polyisobutene Phenyl Trimethicone Sucrose Glycerin Polyglyceryl3 Beeswax Cetyl Esters Isostearyl Neopentanoate Peg100 Stearate HdiTrimethylol Hexyllactone Crosspolymer Cetearyl Glucoside Acetyl Glucosamine Sigesbeckia Orientalis St PaulS Wort Extract Yeast ExtractFaexExtrait De Levure Methyl Glucose Sesquistearate Centaurium Erythraea Centaury Extract Micrococcus Lysate Polysilicone11 Acetyl Octapeptide3 Acetyl Hexapeptide8 Ergothioneine Biotin Whey ProteinLactis ProteinProteine Du PetitLait Ursolic Acid Dipeptide Diaminobutyroyl Benzylamide Diacetate Glycine Soja Soybean Protein Tocopheryl Acetate Camellia Sinensis Leaf Extract Isoleucine Saccharomyces Ferment Filtrate Leucine Soy Amino Acids Carbomer Polymethyl Methacrylate Hydroxyethyl Urea Caffeine Caprylyl Glycol Pyrus Malus Apple Fruit Extract Polybutene Hydrolyzed Soy Protein Dimethicone Sodium Hyaluronate Linoleic Acid Stearic Acid Aminomethyl Propanol Adenosine Phosphate Acetyl Carnitine Hcl Creatine Menthanediol Lecithin Aminopropyl Ascorbyl Phosphate Silica 12Hexanediol Calcium Chloride Hydroxyethylcellulose Sodium Citrate Citric Acid Disodium Edta Potassium Sorbate Bht Sodium Benzoate Sodium Dehydroacetate Phenoxyethanol Ext Violet 2 Ci 60730
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting, priced at 106 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 25oz75ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting sold for 82 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Smart Clinical Repair Lifting Face Neck Cream SMART CLINICAL REPAIR MICRO LIFT CREAMBenefitsAll Skin TypesClinically proven to visibly lift skin on face and neck visibly reduce lines and wrinkles and smooth neck crepinessFormulated with multipeptides to help boost skins natural collagen production to help boost skins strengthSkin looks smoother and more lifted and feels firmerPlumps with instant and longlasting hydrationBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeNonacnegenicFree of Fragrance Parabens Phthalates Sodium lauryl sulfate Sodium laureth sulfate synthetic colors drying alcoholKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinMultipeptides Support skins strength which helps skin look more lifted and lines and wrinkles look reducedHyaluronic acid jojoba oil and shea butter Blend of moisturizing ingredients helps hydrate restore suppleness and visibly smooth fine dry linesDaily moisturizer for face and neck supports skins strength which helps skin look more lifted and lines and wrinkles look reduced The formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research Results100 show a more liftedlooking face and neck100 show a less crepeylooking neckPercentage of women in an index combining improvement in neck jawline and cheek sagging clinical testing on 36 women after using product for 12 weeks97 show visibly reduced crows feet lines97 show visibly reduced lines and wrinkles on neckClinical testing on 36 women after using the product for 12 weeks Smart Clinical Repair Lifting Face Neck Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333144756
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 77 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 77 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Face Cream CLNQSMRTCLNCLRPRWRKLCRCTGCRM 25OZBenefitsAll Skin TypesAntiwrinkle face cream strengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydration which helps minimize the appearance of fine dry linesAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleSafe for sensitive skinAllergy TestedFragrance freeKey IngredientsPowered by peptides this antiwrinkle face cream helps strengthen skin and visibly repair lines and wrinklesCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinLeveraging Cliniques 35 years of peptide expertise formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research ResultsSensory testing applies only to the Cream formula for All Skin TypesAfter 1 use 91 of 148 women say skin looks smoother and feels firmerAfter 1 week95 of 148 women say skin feels hydrated throughout the day95 say skin feels hydrated throughout the nightAfter 4 weeks92 of 146 women say skin feels firmer92 of 146 women say skin looks smoother93 of 146 women say neck feels smoother94 of 146 women say skin looks healthier85 of 143 women say lines and wrinkles look reduced Clinique Smart Clinical Repair Wrinkle Correcting Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125120
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting, priced at 106 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Smart Clinical Repair Lifting Face Neck Cream SMART CLINICAL REPR MCRO LIFT CRM 75SZBenefitsAll Skin TypesClinically proven to visibly lift skin on face and neck visibly reduce lines and wrinkles and smooth neck crepinessFormulated with multipeptides to help boost skins natural collagen production to help boost skins strengthSkin looks smoother and more lifted and feels firmerPlumps with instant and longlasting hydrationDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeKey IngredientsMultipeptides Support skins strength which helps skin look more lifted and lines and wrinkles look reducedHyaluronic acid jojoba oil and shea butter Blend of moisturizing ingredients helps hydrate restore suppleness and visibly smooth fine dry linesResearch Results100 show a more liftedlooking face and neck100 show a less crepeylooking neckClinical testing on 36 women after using the product for 12 weeks Smart Clinical Repair Lifting Face Neck Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333228272
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 100 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Face Cream CLNQ SMRT CLNCL RPR WRKL CRCTG CRMBenefitsAll Skin TypesStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherPlumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinResearch ResultsSensory testing applies only to the Cream formula for All Skin TypesAfter 1 use 91 of 148 women say skin feels nourishedAfter 1 week95 of 148 women say skin feels hydrated throughout the day95 say skin feels hydrated throughout the nightAfter 4 weeks85 of 143 women see reduced lines and wrinkles89 of 146 women say skin feels stronger93 say neck feels smoother94 say skin looks healthier Clinique Smart Clinical Repair Wrinkle Correcting Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333149744
Discover information, advice, and prices for Pure Daily Care Unisex NanoSteamer sold for 75 $ , available in the Face Care category; this product is sold by Gilt.com and made by Pure.
NanoSteamer Clinical 10in1 Smart Ionic Facial Steamer ClinicalGrade Facial Steaming AtHome The oneofakind revolutionary NanoSteamer Clinical has 6 preprogrammed modes that mimic the exact skincare protocols used by aestheticians and Dermatologists in their offices and spas Save money and time with home treatments when compared to highend professional treatment prices The large capacity tank allows for the longest steaming time available up to a full hour or more and the autoshutoff sensor safely powers down the device DualNozzle 360rotation Treatments The only athome steamer to feature a complete range of motion and position possibilities for versatile treatments Two interchangeable attachments Long Nozzle and Short Fluted Nozzle allow you to steam your face while lying down in bed on a couch in a chair long nozzle or at a tabletop at any height short nozzle Focus the steam onto specific areas or allover for a magical spalike experience Skin Transforming 10x Power Smart Steam Enhanced Ionic Steam creates negatively charged particles that help to hydrate moisturize deep clean and provide benefits 10x more effective than ordinary steamers The authentic smart steam technology has revolutionized athome facial care with powerful antiaging and antiblemish technologies in an ecofriendly BPAfree safe design Plus by opening your pores gently your skincare serums and treatments will work better and absorb more deeply 6 Clinical Modes for Easy Fast Results Address concerns like dry skin oily skin aging skin and breakoutprone skin with precisely calibrated modes Using the Digital LCD computer screen select from Cold Mode Cleanse Mode Hot Mode Hydration Mode OilControl Mode and SmartSteam Mode which uses a powerful hot cold combo therapy based on worldclass aesthetic protocols Youll see glowing vibrant skin quickly without irritation or dryness Bonus Features Aromatherapy Extraction Set A special aromatherapy basket allows customizable herbs flowers and beneficial oils to be infused into the steaming protocol for bespoke luxury treatments The included 5piece stainless steel extraction set helps to safely and gently tackle pore concerns like whiteheads blackheads and minimize skin blemishes This makes it the perfect gift for athome users and even for aestheticians looking to enhance professional treatment rooms Imported All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Pure Daily Care Unisex Luma sold for 149.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Pure.
Luma Mask Professional LED Light Therapy Mask for Face and Neck Powerful LED Light Therapy Luma Mask Professional uses natural light energy to treat skin It has 219 clinical grade LED diodes that emit 7 customized wavelength colors Red Light helps for antiaging collagen production Blue Light helps fight blemishes balance oily skin Green Light improves dark spots uneven skin tone Yellow Light helps red sensitive skin Purple Light rejuvenates skin cells Cyan Light soothes irritated skin White Light improves results of topical skincare Face Neck LED Mask Complete Package 2 powerful LED Light Therapy masks in 1 package Face Neck Treat your full face and neck decollete Incredible affordability for flawless looking skin Compare the Luma Mask Pro to other brands that only offer 1 or 2 LED colors and charge up to 2x more for ONLY the face mask Luma Mask includes Pro 7 colors red blue cyan green yellow purple and white Incredible Value for a 360 approach to aging breakouts and more Dermatologist Grade Results Using the same technology once available only to dermatologists estheticians the Luma Mask Professional delivers remarkable results Get a celebrity red carpet facial at home without the price or hassle of leaving home This ultraaffordable device is designed in the USA and comes with a 1year warranty Supercharge your skincare regimen by using serums after the LED treatment for faster results tackling wrinkles fine lines breakouts and hyperpigmentation UltraComfortable and Easy This new improved version of the original Luma Mask has flexible lightweight silicone and comes with adjustable straps to conform to the contours of the face neck and chest 2 Sets of Eye Area Comfort Inserts ensure a comfortable and safe fit around the delicate eye area The UltraPortable mask doesnt need to be connected to an outlet during use allowing you to use Luma Mask Pro all around the home on walks outside or even at the office Complete LED AtHome Package Comes in a beautiful box for easy storage and protects the masks from heat light and moisture Includes 10 components 1 LED face mask 1 LED neck and chest mask 2 adjustable elasticized straps light controller 2 sets of eye area comfort inserts charge cord and user guide Give the gift of youngerlooking clearer and brighter skin to yourself or someone you love Imported All items for external use only
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Even Better Clinical Radical sold for 155 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Potent dark spot serum for hyperpigmentation helps visibly improve dark spots and uneven skin tone See a 39 visible reduction in dark spots in 12 weeks Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Even Better Clinical trade Radical Dark Spot Corrector Interrupter 34 fl oz100 ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 108 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 17oz50ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Even Better Clinical Radical sold at 88 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Potent dark spot serum for hyperpigmentation helps visibly improve dark spots and uneven skin tone See a 39 visible reduction in dark spots in 12 weeks Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Even Better Clinical trade Radical Dark Spot Corrector Interrupter 17 fl oz50 ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 80 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 1oz30ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 99 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Our antiaging eye cream for wrinkles helps strengthen delicate eyearea skin making it smoother brighter and youngerlooking Helps visibly depuff eyes too 100 feel a smoother eye area Dermatologist tested Safe for sensitive eyes and contact lens wearers Safe for sensitive skin around eyes Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Eye Cream 1oz30ml
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Even Better Clinical Radical sold for 57 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Potent dark spot serum for hyperpigmentation helps visibly improve dark spots and uneven skin tone See a 39 visible reduction in dark spots in 12 weeks Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Even Better Clinical trade Radical Dark Spot Corrector Interrupter 10 fl oz30 ml
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Smart Clinical Repair AM sold for 35 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Targeted retinoid treatment that instantly softens and plumps fine dry lines and targets deeper ones over time too Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Please note This product is excluded from discounts Clinique Smart Clinical Repair trade AMPM Retinoid Balm 01oz3g
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 77 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Wrinklefighting cream helps strengthen and nourish for smoother youngerlooking skin Please Note 15ml size is excluded from additional discounts Clinique Smart Clinical Repair trade Wrinkle Correcting Rich Cream 17oz50ml
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Even Better Clinical Radical sold for 21 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Potent dark spot serum for hyperpigmentation helps visibly improve dark spots and uneven skin tone See a 39 visible reduction in dark spots in 12 weeks Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Even Better Clinical trade Radical Dark Spot Corrector Interrupter 033 fl oz10ml
Condition: new
Disponibility: in_stock