Discover information, advice, and prices for GOOPGENES All in One Nourishing sold for 103.99 $ , available in the Face Care category; this product is sold by Thedetoxmarket.com and made by goop.
Allinone hydration This luxuriously rich super cream is crafted from a blend of ultranourishing ingredientsplantbased ceramides schisandra fruit and illipe butterto instantly plump soften brighten and smooth the look of dry aging skin With daily use the fragrancefree vegan formula promotes longlasting moisture and visible supplenessnow and for years to come
Condition: new
Disponibility: in_stock
Shipping: 5.99
Delivery Time: 2-7 business days
EAN: 0850026647372
Find tips, reviews, and features on ELEMIS Skin Nourishing Shower Cream sold for 32.99 $ , available in the Face Care category; this product belongs to ELEMIS and is sold by Gilt.com.
Skin Nourishing Shower Cream 101oz Made in the UK All items for external use only
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Elemis Skin Nourishing 10 1oz sold at 29.99 $ ; this product is listed in the Face Care category, produced by ELEMIS, and sold by Gilt.com.
101oz Cream This exquisite shower cream gently cleanses whilst enriching the body and balancing the acid mantle Cleanses conditions softens Suitable for use during pregnancy Use in the shower morning and evening Ingredients Milk proteins oat extract camellia oil macademia seed oil and jojoba seed oil Made in England
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Avene RICH Revitalizing Nourishing Cream sold for 42 $ , available in the Face Care category; this product belongs to Avène and is sold by Ulta.com.
RICH Revitalizing Nourishing Cream RICH REVITALIZING NOURISHING CREAM 16OZBenefitsUltra rich cream helps restore skins natural healthy barrier while preventing moisture lossFormulated to minimize risk of allergic reactionsWont clog poresSkins natural barrier is left strengthened helping protect against environmental stress and pollution for a natural flowing complexionImmediately replenishes lipids while preventing moisture loss to dull fatigued skinSkin is revitalized soft and glowingKey IngredientsRed Fruit Extract helps restore skins natural healthy barrier by providing nutrient rich lipidsPreTocopheryl a photostable form of Vitamin E provides powerful antioxidant protection against free radicalsShea Butter intensely nourishes and provides comfortAvne Thermal Spring Water clinically proven to soothe soften and calm skinFormulated WithoutParabenSoyWheatMineral OilAnimal derived ingredients RICH Revitalizing Nourishing Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 3282770209396
Explore tips, opinions, and features on GA DE Women s 1 sold at 39.99 $ ; this product is listed in the Face Care category, produced by GA-DE, and sold by Gilt.com.
Aqua Jolt HydraNourishing Night Cream 17oz Measures approximately 3in x 3in x 5in Suitable for normal skin types Treat your skin to a regenerating drink of hydration with Gade Aqua Jolt HydraNourishing Night Cream Wake up to hydrated and replenished skin with renewed strength Skin is intensely hydrated replenished and stronger Formulated with the supereffective natural moisturizing active H22 extracted from tamarind seeds to promote a high level of hydration that lasts over the long term while also increasing skins elasticity and smoothness This cream is perfect for oily combination skin thanks to its rich yet lightweight texture Apply onto clean face and neck in the evening Massage until fully absorbed Ingredients AquaWater Squalane Cyclopentasiloxane Propanediol CocoCaprylate Butyrospermum Parkii Shea Butter Glycerin Hydroxyethyl Acrylate Sodium Acryloyl Dimethyl Taurate Copolymer Undecane Tridecane Methyl Gluceth20 Dimethicone Phenoxyethanol Panthenol Cetyl Alcohol Glyceryl Stearate Xylitylglucoside Cyclohexasiloxane Pentylene Glycol Anhydroxylitol Allantoin Peg75 Stearate DimethiconeVinyl Dimethicone Crosspolymer AcrylatesC1030 Alkyl Acrylate Crosspolymer Imidazolidinyl Urea Xylitol Ceteth20 Steareth20 Tamarindus Indica Seed Gum Ethylhexylglycerin Disodium Edta FragranceParfum Tocopheryl Acetate Sodium Hydroxide Glucose Biosaccharide Gum1 Malva Sylvestris Mallow Flower Extract Sodium Hyaluronate Orchis Mascula Extract Zingiber Officinale Ginger Extract Ci 42090 Ci 16035 Sodium Benzoate Potassium Sorbate Citric Acid Limonene Linalool Hexyl Cinnamal Citronellol This product is not tested on animals Imported All items for external use only
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
Discover information, advice, and prices for KORRES Greek Yoghurt Nourishing Probiotic sold for 42 $ , available in the Face Care category; this product is sold by Ulta.com and made by Korres.
Greek Yoghurt Nourishing Probiotic GelCream GRK YGHRT NRSHNG PRBTC GL CRM 135OZBenefitsDosed dewy hydrationNourishing pre probioticsCalms sensitive skinDermatologically testedVegetarian friendlyNoncomedogenicSilicone freeCruelty freeRecyclable packagingKey IngredientsGreek Yoghurt NourishesSea Water Locksin hydrationPassion Flower Bouncy plumpnessResearch Results100 saw improvement in skin moisture and softness after one use91 saw more balanced comforted and stronger looking skin after one use91 saw improvement in skins overall appearance after one use Greek Yoghurt Nourishing Probiotic GelCream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 5203069106460
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 100 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Face Cream CLNQ SMRT CLNCL RPR WRKL CRCTG CRMBenefitsAll Skin TypesStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherPlumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinResearch ResultsSensory testing applies only to the Cream formula for All Skin TypesAfter 1 use 91 of 148 women say skin feels nourishedAfter 1 week95 of 148 women say skin feels hydrated throughout the day95 say skin feels hydrated throughout the nightAfter 4 weeks85 of 143 women see reduced lines and wrinkles89 of 146 women say skin feels stronger93 say neck feels smoother94 say skin looks healthier Clinique Smart Clinical Repair Wrinkle Correcting Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333149744
Discover information, advice, and prices for CeraVe Skin Renewing Day Cream sold for 34.94 $ , available in the Face Care category; this product is sold by Ulta.com and made by CeraVe.
Skin Renewing Day Cream Face Moisturizer with SPF 30 Retinol SKIN RENEW DAY CREAM SPF 30 17OZBenefitsDaytime face moisturizer with SPF improves the appearance of fine lines and skin texture with encapsulated retinolProvides broadspectrum sunscreen protection against UVA and UVB raysHelps restore the protective skin barrier with three essential ceramidesHelps attract moisture to the skin with hyaluronic acidGentle nonirritating formulaHypoallergenicNoncomedogenicDeveloped with dermatologistsKey IngredientsEncapsulated retinol helps smooth surface texture and improve the look of fine linesCeramides help restore and maintain the skins natural barrierHyaluronic acid attracts hydration to the skins surface and helps skin retain moistureMVE Technology a patented delivery system continually releases moisturizing ingredientsFormulated WithoutFragrance Skin Renewing Day Cream Face Moisturizer with SPF 30 Retinol
Condition: new
Disponibility: in_stock
Shipping: 6.95
Delivery Time: 3-8 Business Days
EAN: 3606000537507
Discover information, advice, and prices for Avene Cicalfate Restorative Protective Cream sold for 34.95 $ , available in the Body Care category; this product is sold by Ulta.com and made by Avène.
Cicalfate Restorative Protective Cream CICALFATE RESTR PROTECTIVE CRM 13OZBenefitsRich nourishing skin barrier cream infused with postbiotic restorative ingredient helps protect skin from external aggressors while maintaining proper hydrationFormulated to minimize risk of allergic reactionsWont clog poresSafe for infants children and adultsVersatile cream helps promote and maintain healthy balanced skin microbiomeHelps accelerate the skin recovery process by 4X Evaluation of visible reduction in appearance of skin treated with Cicalfate vs nontreated skinSuitable for every skinSOS Its great as a daily moisturizer and helps restore burns including sunburn cuts scrapes stiches bug bites perioral and diaper areas and soothes skin prone to redness or drynessSuitable for skin thats compromised aka sensitive dry damagesKey IngredientsC Restore postbiotic restorative ingredient is rich in proteins that help skin restoration while preserving skins natural barrierCopper Zinc Sulfate Complex helps promote and maintain a healthy skin environmentAvne Thermal Spring Water clinically shown to soothe soften and calm skinFormulated WithoutFragranceParabenAlcoholSoyWheat Cicalfate Restorative Protective Cream
Condition: new
Disponibility: in_stock
Shipping: 6.95
Delivery Time: 3-8 Business Days
EAN: 3282770204667
Discover information, advice, and prices for Avene Cicalfate Restorative Protective Cream sold for 42 $ , available in the Body Care category; this product is sold by Ulta.com and made by Avène.
Cicalfate Restorative Protective Cream CICALFATE REST PROTC CREAM 33OZBenefitsRich nourishing skin barrier cream infused with postbiotic restorative ingredient helps protect skin from external aggressors while maintaining proper hydrationFormulated to minimize risk of allergic reactionsWont clog poresSafe for infants children and adultsVersatile cream helps promote and maintain healthy balanced skin microbiomeHelps accelerate the skin recovery process by 4X Evaluation of visible reduction in appearance of skin treated with Cicalfate vs nontreated skinSuitable for every skinSOS Its great as a daily moisturizer and helps restore burns including sunburn cuts scrapes stitches bug bites perioral and diaper areas and soothes skin prone to redness or drynessSuitable for skin thats compromised aka sensitive dry damagedKey IngredientsC Restore postbiotic restorative ingredient is rich in proteins that help skin restoration while preserving skins natural barrierCopper Zinc Sulfate Complex helps promote and maintain a healthy skin environmentAvne Thermal Spring Water clinically shown to soothe soften and calm skinFormulated WithoutFragranceParabenAlcoholSoyWheat Cicalfate Restorative Protective Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 3282770204681
Discover information, advice, and prices for Savor Beauty Women s 2oz sold for 56.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Savor Beauty.
Truffle Face Cream Normal 2oz Suitable for normal skin types Savor Beautys 1 Bestseller Face Cream The Truffle Face Cream fuses the brightening power of White Truffle Extract with an antioxidantrich blend of vitamins A E and B nourishing omega fatty acids and skinsoothing gluconolactone PHA Visibly reduces fine lines enhances elasticity and deeply moisturizes for luminous velvetysoft skin Use Truffle Face Cream daily morning and night after cleansing and toning skin Warm a pearlsized amount of cream between hands Massage onto face and neck to melt cream into the skin Ingredients Aloe Barbadensis Aloe Vera Leaf Juice Rosa Canina Rosehip Fruit Oil Theobroma Cacao Cocoa Seed Butter Emulsifying Wax Nf Veg Cucurbita Pepo Pumpkin Seed Oil Helianthus Annuus Sunflower Seed Oil And Extracts Of Tuber Magnatum White Truffle And Salvia Officinalis Sage Leaf Extract And Foeniculum Vulgare Fennel Seed Extract And Borago Officinalis Leaf Extract Vegetable Glycerin Stearic Acid Veg Rubus Idaeus Red Raspberry Seed Oil Butyrospermum Parkii Shea Butter Fruit Oryza Sativa Rice Bran Oil Tocopherol Vit E Gluconolactone Sodium Benzoate Calcium Gluconate Sodium Levulinate Sodium Anisate Fragrance 100 Essential Oil PAnisic Acid AniseCertified Organic This product is not tested on animals This product is noncomedogenic This product is parabenfree Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Savor Beauty Women s 2oz sold at 56.99 $ ; this product is listed in the Face Care category, produced by Savor Beauty, and sold by Gilt.com.
Truffle Face Cream Oily 2oz Suitable for oily skin Savor Beautys 1 Bestseller Face Cream The Truffle Face Cream fuses the brightening power of White Truffle Extract with an antioxidantrich blend of vitamins A E and B nourishing omega fatty acids and skinsoothing gluconolactone PHA Visibly reduces fine lines enhances elasticity and deeply moisturizes for luminous velvetysoft skin Use Truffle Face Cream daily morning and night after cleansing and toning skin Warm a pearlsized amount of cream between hands Massage onto face and neck to melt cream into the skin Ingredients Aloe Barbadensis Aloe Vera Leaf Juice Citrullus Lanatus Wild Watermelon Seed Oil Theobroma Cacao Cocoa Seed Butter Emulsifying Wax Nf Veg Helianthus Annuus Sunflower Seed Oil And Extracts Of Tuber Magnatum White Truffle And Daucus Carota Sativa Carrot Root Extract And Chamomilla Recutita Matricaria Flower Extract And Carica Papaya Papaya Fruit Extract Stearic Acid Veg Vegetable Glycerin Vitis Vinifera Grape Seed Oil Tocopherol Vit E Canina Rosehip Fruit Oil Gluconolactone Sodium Benzoate Calcium Gluconate Sodium Levulinate Sodium Anisate Fragrance 100 Essential Oil PAnisic Acid Anise Certified Organic This product is not tested on animals This product is noncomedogenic This product is parabenfree Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Savor Beauty Women s 2oz sold for 56.99 $ , available in the Face Care category; this product belongs to Savor Beauty and is sold by Gilt.com.
Truffle Face Cream Dry 2oz Suitable for dry skin types Savor Beautys 1 Bestseller Face Cream The Truffle Face Cream fuses the brightening power of White Truffle Extract with an antioxidantrich blend of vitamins A E and B nourishing omega fatty acids and skinsoothing gluconolactone PHA Visibly reduces fine lines enhances elasticity and deeply moisturizes for luminous velvetysoft skin Use Truffle Face Cream daily morning and night after cleansing and toning skin Warm a pearlsized amount of cream between hands Massage onto face and neck to melt cream into the skin Ingredients Aloe Barbadensis Aloe Vera Leaf Juice Limnanthes Alba Meadowfoam Seed Oil Theobroma Cacao Cocoa Seed Butter Emulsifying Wax Nf Veg Rosa Canina Rosehip Fruit Oil Helianthus Annuus Sunflower Seed Oil And Extracts Of Tuber Magnatum White Truffle And Lavandula Angustifolia Lavender Flower Extract And Ginkgo Biloba Leaf Extract And Prunus Armeniaca Apricot Fruit Extract Vegetable Glycerin Rubus Idaeus Red Raspberry Seed Oil Stearic Acid Veg Butyrospermum Parkii Shea Butter Fruit Oenothera Biennis Evening Primrose Oil Tocopherol Vit E Gluconolactone Sodium Benzoate Calcium Gluconate Sodium Levulinate Sodium Anisate Fragrance 100 Essential Oil PAnisic Acid Anise Certified Organic This product is not tested on animals This product is noncomedogenic This product is parabenfree Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on L Erbolario LErbolario 1oz Face sold for 27.99 $ , available in the Face Care category; this product belongs to L'Erbolario and is sold by Gilt.com.
Face Cream for Delicate and Red Skin 1oz A skinprotective cream that helps treat couperose and is specific for skin that is very sensitive and prone to reddening When used an a daily basis this Face Cream with Chamomile Butchers broom and Liquorice prevents rashes and reduces redness This product is not tested on animals Made in Italy All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for L Erbolario 1 6oz Toning sold for 29.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by L'Erbolario.
Toning Face Cream 16oz This Toning Cream helps your skin repair the damage from daily atmospheric aggressions nourishing skin tissue and firming your facial features It will permeate your skin with a pleasant sensation of freshness and elasticity Active ingredients Aqua Water Dicaprylyl Ether Glycerin CaprylicCapric Triglyceride Glyceryl Stearate Cetearyl Alcohol Triolein Butyrospermum Parkii Shea Butter Simmondsia Chinensis Jojoba Seed Oil Hydrogenated Olive Oil Unsaponifiables LeuconostocRadish Root Ferment Filtrate Cera Alba Beeswax Mangifera Indica Mango Seed Oil Prunus Amygdalus Dulcis Sweet Almond Oil Oryzanol Glucose Sodium PCA Glutamic Acid Glycine Lysine Allantoin Brassica Campestris Rapeseed Seed Oil Rosmarinus Officinalis Rosemary Leaf Extract Caprylyl CaprylateCaprate CocoCaprylate Citric Acid C1018 Triglycerides Glyceryl Dioleate Potassium Palmitoyl Hydrolyzed Rice Protein Sucrose Stearate Xanthan Gum Parfum Fragrance Benzyl Alcohol Sodium Anisate Sodium Levulinate Sodium Phytate This product is not tested on animals Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for StriVectin 1 7oz Tightening Sculpting sold for 75.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by StriVectin.
17oz Tightening Sculpting Face Cream Intensely nourishing face cream plumps lifts and firms the appearance of skin to visibly sculpt and redefine lost contours Ingredients Aesculus Hippocastanum Horse Chestnut Bark Extract Paeonia Albiflora Root Extract Nannochloropsis Oculata Extract Made in the USA
Condition: new
Disponibility: in_stock
EAN: 0810907024241
Discover information, advice, and prices for THE FACE SHOP Yehwadam Hwansaenggo sold for 37.71 $ , available in the Make up category; this product is sold by Yesstyle.com and made by THE FACE SHOP.
Brand from South Korea THE FACE SHOP BenefitsAn ultranourishing eye cream hydrates and improves elasticity of fatigued skin around the eye areaFormulated with different kinds of Korean traditional herb delivering nourishment firming whitening benefitsThis premium antiaging eye cream helps restore the vitality of skin to against signs of agingHow to useApply a generous amount around eye area after emulsion then gently tap with fingertips for better absorption
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 8801051616170
Discover information, advice, and prices for Aveeno Calm Restore Redness Relief, priced at 33.94 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Aveeno.
Calm Restore Redness Relief Cream Face Moisturizer CALM RESTORE REDNESS MOISTURE 17OZBenefitsMoisturizing cream instantly calms soothes reduces the appearance of redness on the faceFace cream features feverfew oat in a calming nourishing formula to soothe irritated dry skinCalm Restore Redness Relief moisturizer is both dermatologisttested tested on sensitive skinCalm Restore Redness Relief moisturizer from a dermatologistrecommended brand for over 70 yearsKey IngredientsGentle facial cream contains ceramide vitamin B5 helps restore skins moisture barrierFormulated WithoutFragrancesPhthalates Calm Restore Redness Relief Cream Face Moisturizer
Condition: new
Disponibility: in_stock
Shipping: 6.95
Delivery Time: 3-8 Business Days
EAN: 0381372022471
Explore tips, opinions, and features on Kahina Giving Beauty Face Cream sold at 110.99 $ ; this product is listed in the Face Care category, produced by Kahina Giving Beauty, and sold by Thedetoxmarket.com.
Creamy moisturizing rich just a few ways we can describe this lavish cream Brimming with argan oil and grapederived resveratrol and polyphenols the nourishing formula deeply hydrates for a supersoft complexion Especially wonderful for dry and mature skin types this luxurious blend soothes skin and minimizes the look of fine lines
Condition: new
Disponibility: in_stock
Shipping: 5.99
Delivery Time: 2-7 business days
EAN: 0857484002170