Explore tips, opinions, and features on Avene Cicalfate Restorative Protective Cream sold at 34.95 $ ; this product is listed in the Body Care category, produced by Avène, and sold by Ulta.com.
Cicalfate Restorative Protective Cream CICALFATE RESTR PROTECTIVE CRM 13OZBenefitsRich nourishing skin barrier cream infused with postbiotic restorative ingredient helps protect skin from external aggressors while maintaining proper hydrationFormulated to minimize risk of allergic reactionsWont clog poresSafe for infants children and adultsVersatile cream helps promote and maintain healthy balanced skin microbiomeHelps accelerate the skin recovery process by 4X Evaluation of visible reduction in appearance of skin treated with Cicalfate vs nontreated skinSuitable for every skinSOS Its great as a daily moisturizer and helps restore burns including sunburn cuts scrapes stiches bug bites perioral and diaper areas and soothes skin prone to redness or drynessSuitable for skin thats compromised aka sensitive dry damagesKey IngredientsC Restore postbiotic restorative ingredient is rich in proteins that help skin restoration while preserving skins natural barrierCopper Zinc Sulfate Complex helps promote and maintain a healthy skin environmentAvne Thermal Spring Water clinically shown to soothe soften and calm skinFormulated WithoutFragranceParabenAlcoholSoyWheat Cicalfate Restorative Protective Cream
Condition: new
Disponibility: in_stock
Shipping: 6.95
Delivery Time: 3-8 Business Days
EAN: 3282770204667
Find tips, reviews, and features on Avene Cicalfate Restorative Protective Cream sold for 42 $ , available in the Body Care category; this product belongs to Avène and is sold by Ulta.com.
Cicalfate Restorative Protective Cream CICALFATE REST PROTC CREAM 33OZBenefitsRich nourishing skin barrier cream infused with postbiotic restorative ingredient helps protect skin from external aggressors while maintaining proper hydrationFormulated to minimize risk of allergic reactionsWont clog poresSafe for infants children and adultsVersatile cream helps promote and maintain healthy balanced skin microbiomeHelps accelerate the skin recovery process by 4X Evaluation of visible reduction in appearance of skin treated with Cicalfate vs nontreated skinSuitable for every skinSOS Its great as a daily moisturizer and helps restore burns including sunburn cuts scrapes stitches bug bites perioral and diaper areas and soothes skin prone to redness or drynessSuitable for skin thats compromised aka sensitive dry damagedKey IngredientsC Restore postbiotic restorative ingredient is rich in proteins that help skin restoration while preserving skins natural barrierCopper Zinc Sulfate Complex helps promote and maintain a healthy skin environmentAvne Thermal Spring Water clinically shown to soothe soften and calm skinFormulated WithoutFragranceParabenAlcoholSoyWheat Cicalfate Restorative Protective Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 3282770204681
Discover information, advice, and prices for BNX N95 H95 Protective Face sold for 89.99 $ , available in the Safety Workwear & Equipment category; this product is sold by Homedepot.com and made by BNX.
Ideal for use by healthcare and frontline workers as well in crowded or contaminated areas such as commercial buildings construction food processing and safety retail manufacturing infrastructure education oil and gas transportation and more Vertical folding design Blocks 95 of airborne particles Color Black
Condition: new
Disponibility: in_stock
EAN: 0850027430935
Explore tips, opinions, and features on BNX N95 F95 Protective Face sold at 37.5 $ ; this product is listed in the Safety Workwear & Equipment category, produced by BNX, and sold by Homedepot.com.
NIOSH approved N95 respirator mask NIOSH approval number TC84A9362 N95 mask certified for protection against 95 of nonoilbased particles 03 microns or larger Flat fold design allows for convenient storage prior to use Extremely breathable up to 50 plus more breathable than NIOSH minimum requirement Color Black
Condition: new
Disponibility: in_stock
EAN: 0850033221251
Explore tips, opinions, and features on DR TALBOT S Disposable Girl sold at 71.97 $ ; this product is listed in the Safety Workwear & Equipment category, produced by DR. TALBOT'S, and sold by Homedepot.com.
High pollen count means lots of sneezing and less fun while playing outdoors These kids face masks will help you and your little one enjoy your time outdoors sneezefree High pollen count means lots of sneezing and less fun while playing outdoors Each mask is made of soft breathable fabric and comes in colorful patterns and fun designs The built in bendable nose clip makes it easy to adjust the mask to fit your childs face Our masks are made to fully cover your childs nose and mouth providing more thorough protection Soft ear loops make the mask comfortable for longer wear keeping little ears from hurting These kid face masks arent only for outdoor use either The masks can be used indoors when doing chores to avoid sneezing and irritation caused by dust and dirt Not intended to be used as a toy Color Girl Prints
Condition: new
Disponibility: in_stock
EAN: 0370797800993
Discover information, advice, and prices for Erborian CC Creme Face Cream sold for 46 $ , available in the Make up category; this product is sold by Ulta.com and made by Erborian.
CC Cream SPF 25 CC CREME CARAMELBenefitsBlurs the appearance of pores and imperfectionsEvens out your skin toneEnhances your skins natural radiance and provides light coverageFeaturesThe CC Creams initial white pigments transform to match your skin tone when blended into the skin for a seamless shade matchThe result is a more evenlooking complexion that looks like youve applied a filterEnriched with Centella Asiatica this CC Cream also helps to hydrate and protect your skinFormulated with broadspectrum SPF 25 to help shield your skin from harmful UVAUVB rays that cause dark spots and wrinklesFormulated WithoutParabensSulfatesPhthalatesErborian CC Creme Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 8809255783995
Discover information, advice, and prices for Damascus Protective Gear Riot Control, priced at 119.99 $ : it belongs to the Safety Workwear & Equipment category; this product is sold by Opticsplanet.com and made by Damascus Protective Gear.
Condition: new
Disponibility: in_stock
EAN: 0736404727211
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting, priced at 82 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 17oz50ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Smart Clinical Repair Lifting sold at 106 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 25oz75ml
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Protective Face Shields by Windy sold for 134.4 $ , available in the Party Dresses, Costumes & Accessories category; this product belongs to Windy City Novelties and is sold by Windycitynovelties.com.
Prevent fluid splashing with our clear protective face shields Order face shields in bulk from Windy City Novelties for all of your friends or coworkers
Condition: new
Disponibility: in_stock
EAN: 0716148990973
Discover information, advice, and prices for Outsunny 8 2 ft Steel, priced at 130.59 $ : it belongs to the Garden Furniture category; this product is sold by Homedepot.com and made by Outsunny.
This Outsunnys netting gazebo adds a functional touch to any outdoor space like patio backyard With solid steel frame in polyester covering this gazebo offers the ultimate shade solution and maintains the well air circulation You can relax in the comfort of your outside house without worrying the disturbance of unwanted elements Also it will be a great space for you to entertain your friends and family members Color White
Condition: new
Disponibility: in_stock
EAN: 0842525106726
Explore tips, opinions, and features on Clinique Smart Clinical Repair Lifting sold at 82 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Ulta.com.
Smart Clinical Repair Lifting Face Neck Cream SMART CLINICAL REPAIR MICRO LIFT CREAMBenefitsAll Skin TypesClinically proven to visibly lift skin on face and neck visibly reduce lines and wrinkles and smooth neck crepinessFormulated with multipeptides to help boost skins natural collagen production to help boost skins strengthSkin looks smoother and more lifted and feels firmerPlumps with instant and longlasting hydrationBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeNonacnegenicFree of Fragrance Parabens Phthalates Sodium lauryl sulfate Sodium laureth sulfate synthetic colors drying alcoholKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinMultipeptides Support skins strength which helps skin look more lifted and lines and wrinkles look reducedHyaluronic acid jojoba oil and shea butter Blend of moisturizing ingredients helps hydrate restore suppleness and visibly smooth fine dry linesDaily moisturizer for face and neck supports skins strength which helps skin look more lifted and lines and wrinkles look reduced The formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research Results100 show a more liftedlooking face and neck100 show a less crepeylooking neckPercentage of women in an index combining improvement in neck jawline and cheek sagging clinical testing on 36 women after using product for 12 weeks97 show visibly reduced crows feet lines97 show visibly reduced lines and wrinkles on neckClinical testing on 36 women after using the product for 12 weeks Smart Clinical Repair Lifting Face Neck Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333144756
Discover information, advice, and prices for Clinique Superpowder Double Face Makeup, priced at 40 $ : it belongs to the Make up category; this product is sold by Ulta.com and made by Clinique.
Superpowder Double Face Makeup Foundation SUPERPOWDER DBL FACE MAKEUP MATTE CREAMBenefitsSkin Types Dry CombinationCoverage ModerateFinish MatteLongwearing 2in1 powder foundation in a portable compactFullcoverage powder works as an overfoundation finisher or as a powder foundationExtracling formula for double coverageDermatologist and ophthalmologist testedNonacnegenicAllergy testedFormulated WithoutParabensPhthalatesOilFragrance Superpowder Double Face Makeup Foundation
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0020714105280
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 77 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
Discover information, advice, and prices for Clinique Redness Solutions Daily Relief sold for 65 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Redness Solutions Daily Relief Face Cream With Probiotic Technology RDNSSLTNSDYRLFCRMWPRBTCTCHNLGY 17OZBenefitsFor any skin with occasional or persistent rednessInstantly calms skins with visible rednessCream visibly soothes redness blotchinessMicrobiome Technology includes Cliniques patented lactobacillus extract which helps visibly soothe to support skins natural microbiomeUse the Clinique Redness Solutions regimen to see an improvement in visible redness cleanse with Soothing Cleanser comfort with Daily Relief Cream protect with Daily Protective Base A consistent nonirritating routine helps get redness under controlDermatologist testedNonacnegenicAllergy testedFormulated WithoutParabensPhthalatesOilDenatured alcoholSLSSLESSulfatesFragrance Redness Solutions Daily Relief Face Cream With Probiotic Technology
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0020714297923
Discover information, advice, and prices for Clinique Smart Clinical Repair Overnight, priced at 80 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Smart Clinical Repair Overnight Recovery Face Cream Mask SMRT CLNCL RPR VRNT RCVRY CRM MSKBenefitsHelps restore your skin barrier which is naturally weaker at night A weaker barrier makes skin more susceptible to external factors which makes it more prone to sensitivityOptimizes skins natural nightly repair process visibly reducing lines and wrinkles and soothing the look of sensitivityPlumps and reduces fine dry lines overnightVisibly corrects wrinkles smooths skin and boosts radiance over timeDelivers rich deep hydrationDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeKey IngredientsAdenosine Naturally occurring nocturnal biomolecule helps visibly quell irritation turning down or soothing sensitivityPeptides Help boost skins strength for a smoother appearance Formula includes neuropeptide and signaling peptides Palmitoyl tripeptide1 Acetyl hexapeptide8 Palmitoyl tetrapeptide712 hyaluronic acid solution Helps hydrate to visibly smooth fine dry linesResearch ResultsOvernightSkin is hydrated feels soothed and skin barrier is strengthenedIn 1 weekCrows feet forehead lines nasolabial folds and neck lines are visibly reducedIn 2 weeks97 show reduced facial lines92 say skin looks healthier94 say skin looks smoother92 say skin looks radiantClinical testing on 33 women after using the product for 1 weekFacial lines refers to crows feet lines Clinical testing on 33 women after using the product for 2 weeksConsumer testing on 132 women after using the product for 2 weeks Smart Clinical Repair Overnight Recovery Face Cream Mask
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333232392
Explore tips, opinions, and features on BNX N95 F95 Protective Face sold at 84.99 $ ; this product is listed in the Safety Workwear & Equipment category, produced by BNX, and sold by Homedepot.com.
NIOSH approved N95 respirator mask NIOSH approval number TC84A9362 N95 mask certified for protection against 95 of nonoilbased particles 03 microns or larger Flat fold design allows for convenient storage prior to use Extremely breathable up to 50 plus more breathable than NIOSH minimum requirement Color White
Condition: new
Disponibility: in_stock
EAN: 0850033221244
Discover information, advice, and prices for BNX N95 F95 Protective Face sold for 24.99 $ , available in the Safety Workwear & Equipment category; this product is sold by Homedepot.com and made by BNX.
NIOSH approved N95 respirator mask NIOSH approval number TC84A9362 N95 mask certified for protection against 95 of nonoilbased particles 03 microns or larger Flat fold design allows for convenient storage prior to use Extremely breathable up to 50 plus more breathable than NIOSH minimum requirement Color Black
Condition: new
Disponibility: in_stock
EAN: 0850027430737
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 77 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Face Cream CLNQSMRTCLNCLRPRWRKLCRCTGCRM 25OZBenefitsAll Skin TypesAntiwrinkle face cream strengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydration which helps minimize the appearance of fine dry linesAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleSafe for sensitive skinAllergy TestedFragrance freeKey IngredientsPowered by peptides this antiwrinkle face cream helps strengthen skin and visibly repair lines and wrinklesCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinLeveraging Cliniques 35 years of peptide expertise formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research ResultsSensory testing applies only to the Cream formula for All Skin TypesAfter 1 use 91 of 148 women say skin looks smoother and feels firmerAfter 1 week95 of 148 women say skin feels hydrated throughout the day95 say skin feels hydrated throughout the nightAfter 4 weeks92 of 146 women say skin feels firmer92 of 146 women say skin looks smoother93 of 146 women say neck feels smoother94 of 146 women say skin looks healthier85 of 143 women say lines and wrinkles look reduced Clinique Smart Clinical Repair Wrinkle Correcting Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125120
Discover information, advice, and prices for BNX N95 F95 Protective Face, priced at 89.99 $ : it belongs to the Safety Workwear & Equipment category; this product is sold by Homedepot.com and made by BNX.
NIOSH approved N95 respirator mask NIOSH approval number TC84A9362 N95 mask certified for protection against 95 of nonoilbased particles 03 microns or larger Flat fold design allows for convenient storage prior to use Extremely breathable up to 50 plus more breathable than NIOSH minimum requirement Color Black
Condition: new
Disponibility: in_stock
EAN: 0850033221268