Discover information, advice, and prices for Premier Luxury Skin Care Perfection sold for 32.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Premier Luxury Skin Care.
Perfection Refining Moisture Cream Suitable for all skin types A multi task gentle moisturizing cream specially formulated to treat the skin for a youthful appearance Helps to condition and rebalance the skin leaving it feeling fresh smooth moisturized and soft Good for all skin types Very light and perfect for daily use Repackaging properties penetrate the skin Promotes the reversal of signs of aging and fatigue Apply onto clean skin and massage gently in soft circular motions until absorbed Ingredients Aqua Deionized Water Eau Isopropyl Palmitate CaprylicCapric Triglyceride Cetearyl Alcohol Peg20 Stearate Propylene Glycol Glyceryl Stearate Se Prunus Amygdalus Dulcis Sweet Almond Oil Simmondsia Chinensis Jojoba Seed Oil Glycine Soja Soybean Oil Hamamelis Virginiana Witch Hazel Water Lecithin Liposome Complex Retinyl Acetate Tocopherol Ginkgo Biloba Leaf Extract Maris SalDead Sea Salt Glycerine Dmdm Hydantoin Iodo Propynyl Butyl Carbamate Methylparaben Ethylparaben Propylparaben Butylparaben Phenoxyethanol Fragrance Parfum Bht Carbomer 980 Triethanolamine Geraniol Hydroxycitronellal Hexyl Cinnamal Linalool Citronllol Benzyl Salicylate Aqua Deionized Water Eau Propylene Glycol Glycerine Sodium Stearate Urea Maris SalDead Sea Salt Ethanolamine Ultramarines Ci 77007 Fragrance Parfum Aloe Barbadensis Leaf Juice Amyl Cinnamal Benzyl Alcohol Citronellol Coumarin Limonene AlphaIsometyl Ionone Geraniol Isoeugenol Butylphenyl Methylpropional Linalool This product is not tested on animals This product is noncomedogenic Imported All items for external use only
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Shiseido Vital Perfection Uplifting and sold at 48 $ ; this product is listed in the Face Care category, produced by Shiseido, and sold by Shiseido.com.
Visibly lift skin in just 1 week and reveal a dramatically firmer revitalized complexion with this rich sculpting anti aging cream for dry skin Clinically tested on 35 women
Condition: new
Disponibility: in_stock
EAN: 0729238179233
Explore tips, opinions, and features on Shiseido Vital Perfection LiftDefine Radiance sold at 84 $ ; this product is listed in the Face Care category, produced by Shiseido, and sold by Shiseido.com.
An instantly effective and powerful 2piece face neck sheet mask for lifting and firming
Condition: new
Disponibility: in_stock
EAN: 0729238169579
Discover information, advice, and prices for MyLi Face Cream Day Night sold for 62.3 $ , available in the Face Care category; this product is sold by Yesstyle.com and made by MyLi.
Brand from France MyLi This generous face cream with many virtues offers intense hydration a radiant luminous and even complexion and a smoother firmer and visibly healthier skinWith Raykami your skin is protected from exposure to blue lights which is one of the top 3 factors responsible for premature skin aging along with the sun and pollutionThe blue lights from our screens penetrate deep into the dermis and gradually reduce the ability of the skin cells to regenerateThe Raykami also protects against the harmful effects of the main UV rays on cellular agingKey ingredientsHyaluronic acid of low and high molecular weight allows to hydrate the skin in depth to plump it to smooth wrinkles and fine lines but also to regulate the production of sebumKalpariane increases skin firmness and elasticityRaykami protective action regulates the homogeneity of the skin thanks to its action on pigmentary tasks on the surface and in depth Protects against blue UV and the aging eff
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 3770027395034
Find tips, reviews, and features on Premier Luxury Skin Care 2 sold for 49.99 $ , available in the Face Care category; this product belongs to Premier Luxury Skin Care and is sold by Gilt.com.
Supreme Face Lift Cream 204oz Suitable for normal skin types A luxurious multifirming rejuvenating and lifting cream which works wonders on the appearance of the skin Designed to effectively combat the appearance of deep wrinkles and assist in improving the skins firmness and radiance for beautiful looking skin Targets the appearance of deep wrinkles Improves skin firmness Giving the skin a radiant appearance Nourishes skin Active ingredients AquaDeionized WaterEau Isopropyl Palmitate CaprylicCapric Triglyceride Cetearyl Alcohol Propylene Glycol Glyceryl Stearate Se Sodium Potassium Aluminum Silicate Prunus Amygdalus Dulcis Sweet Almond Oil Peg20 Stearate Simmondsia Chinensis Jojoba Seed Oil Secale Cereale Rye Seed Extract BetaCarotene Rhodopseudomonas Cyanocobalamin Lecithin Liposome Complex Retinyl Acetate Tocopherol Alanine Glycine Panthenol Tocopheryl Acetate Equisetum Arvense Leaf Extract Ginkgo Biloba Leaf Extract Humulus Lupulus Hops Extract Ilex Paraguariensis Leaf Extract Avena Sativa Oat Kernel Extract Glycerine Maris SalDead Sea Salt Phenoxyethanol Ethylhexylglycerin Carbomer 980 Alcohol Denat FragranceParfum Bht Triethanolamine Benzyl Salicylate Citronellol Coumarin Geraniol Hexyl Cinnamal Hydroxycitronellal Linalool AlphaIsomethyl Ionone This product is not tested on animals Use within 12 months of opening Imported All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Shiseido Vital Perfection Uplifting And sold for 119.2 $ , available in the Face Care category; this product is sold by Yesstyle.com and made by Shiseido.
Brand from Japan Shiseido Vital Perfection is a new proactive skincare range for a lifted and tightened lookInspired by our latest holistic research in skin science neuroscience and other areas of human health Shiseido developed a revolutionary multifaceted skin revitalising solution that reawakens skins potentialThe Uplifting and Firming Cream Enrichedhas a rich luxurious texturethat fights the loss of elasticity wrinkles and dark spotsSkin is moisturised tightened resilient and has a bright lookVital Perfection has been formulated with ReNeura Technology for fast antiageing resultsand the exclusive KURENAITruLift complex that helps to promote resilience and elasticity to improve firmnessVP8 complex with 4MSK is an effective brighteningingredient for an even and radiant lookVital Perfection is powered by ReNeura Technologywhich helps to strengthen skins internal sensory signals declining with age while enhancing and accelerating effects that fight against signs o
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 0768614164531
Explore tips, opinions, and features on Clinique Smart Clinical Repair Lifting sold at 82 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 17oz50ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Shiseido Vital Perfection Uplifting and sold at 132 $ ; this product is listed in the Body Care category, produced by Shiseido, and sold by Shiseido.com.
Visibly lift skin in just 1 week and reveal a dramatically firmer revitalized complexion with this rich sculpting anti aging cream for dry skin Clinically tested on 35 women
Condition: new
Disponibility: in_stock
EAN: 0730852164536
Find tips, reviews, and features on Cl de Peau Beaut Cream sold for 64.95 $ , available in the Make up category; this product belongs to Clé de Peau Beauté and is sold by Cledepeaubeaute.com.
Cream rouge matte Pink Perfection Clé de Peau Beauté Makeup Lip Lipstick Lip Liners
Condition: new
Disponibility: in_stock
Shipping: 14.95
EAN: 0729238182295
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting sold for 106 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 25oz75ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Christian Dior Forever Skin Contour sold at 52.95 $ ; this product is listed in the Face Care category, produced by Christian Dior, and sold by Dior.com.
The 1st Dior Forever contour stick that blends easily and seamlessly with the skin for a naturally sculpted or bronzed effect with 24h wear and hydration Layer Dior Forever Skin Contour over your Dior Forever foundation to achieve a streakfree finish as the creamy texture fuses with the skin In one intuitive step the contour stick warms the complexion illuminates shadowed areas and defines the contours of the face and nose for a customized look that is resistant to even the most extreme heat and humidity Dior Forever Skin Contours weightless formula allows skin to breathe while delivering continuous hydration for a barelythere feel and 24 hours of comfort Noncomedogenic Dermatologically tested Instrumental test on 25 subjects Instrumental test on 33 subjects Instrumental test by photo analysis on 25 women 5 cycles of 10 minutes under heat and humidity condition temperature 3033C and hygrometry 7075 HR Selfrating by 25 subjects
Condition: new
Disponibility: in_stock
Shipping: 5.95
EAN: 3348901726825
Find tips, reviews, and features on Clinique Smart Clinical Repair Lifting sold for 82 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Smart Clinical Repair Lifting Face Neck Cream SMART CLINICAL REPAIR MICRO LIFT CREAMBenefitsAll Skin TypesClinically proven to visibly lift skin on face and neck visibly reduce lines and wrinkles and smooth neck crepinessFormulated with multipeptides to help boost skins natural collagen production to help boost skins strengthSkin looks smoother and more lifted and feels firmerPlumps with instant and longlasting hydrationBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeNonacnegenicFree of Fragrance Parabens Phthalates Sodium lauryl sulfate Sodium laureth sulfate synthetic colors drying alcoholKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinMultipeptides Support skins strength which helps skin look more lifted and lines and wrinkles look reducedHyaluronic acid jojoba oil and shea butter Blend of moisturizing ingredients helps hydrate restore suppleness and visibly smooth fine dry linesDaily moisturizer for face and neck supports skins strength which helps skin look more lifted and lines and wrinkles look reduced The formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research Results100 show a more liftedlooking face and neck100 show a less crepeylooking neckPercentage of women in an index combining improvement in neck jawline and cheek sagging clinical testing on 36 women after using product for 12 weeks97 show visibly reduced crows feet lines97 show visibly reduced lines and wrinkles on neckClinical testing on 36 women after using the product for 12 weeks Smart Clinical Repair Lifting Face Neck Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333144756
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
Find tips, reviews, and features on Clinique Redness Solutions Daily Relief sold for 65 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Redness Solutions Daily Relief Face Cream With Probiotic Technology RDNSSLTNSDYRLFCRMWPRBTCTCHNLGY 17OZBenefitsFor any skin with occasional or persistent rednessInstantly calms skins with visible rednessCream visibly soothes redness blotchinessMicrobiome Technology includes Cliniques patented lactobacillus extract which helps visibly soothe to support skins natural microbiomeUse the Clinique Redness Solutions regimen to see an improvement in visible redness cleanse with Soothing Cleanser comfort with Daily Relief Cream protect with Daily Protective Base A consistent nonirritating routine helps get redness under controlDermatologist testedNonacnegenicAllergy testedFormulated WithoutParabensPhthalatesOilDenatured alcoholSLSSLESSulfatesFragrance Redness Solutions Daily Relief Face Cream With Probiotic Technology
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0020714297923
Find tips, reviews, and features on Clinique Smart Clinical Repair Overnight sold for 80 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Smart Clinical Repair Overnight Recovery Face Cream Mask SMRT CLNCL RPR VRNT RCVRY CRM MSKBenefitsHelps restore your skin barrier which is naturally weaker at night A weaker barrier makes skin more susceptible to external factors which makes it more prone to sensitivityOptimizes skins natural nightly repair process visibly reducing lines and wrinkles and soothing the look of sensitivityPlumps and reduces fine dry lines overnightVisibly corrects wrinkles smooths skin and boosts radiance over timeDelivers rich deep hydrationDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeKey IngredientsAdenosine Naturally occurring nocturnal biomolecule helps visibly quell irritation turning down or soothing sensitivityPeptides Help boost skins strength for a smoother appearance Formula includes neuropeptide and signaling peptides Palmitoyl tripeptide1 Acetyl hexapeptide8 Palmitoyl tetrapeptide712 hyaluronic acid solution Helps hydrate to visibly smooth fine dry linesResearch ResultsOvernightSkin is hydrated feels soothed and skin barrier is strengthenedIn 1 weekCrows feet forehead lines nasolabial folds and neck lines are visibly reducedIn 2 weeks97 show reduced facial lines92 say skin looks healthier94 say skin looks smoother92 say skin looks radiantClinical testing on 33 women after using the product for 1 weekFacial lines refers to crows feet lines Clinical testing on 33 women after using the product for 2 weeksConsumer testing on 132 women after using the product for 2 weeks Smart Clinical Repair Overnight Recovery Face Cream Mask
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333232392
Explore tips, opinions, and features on Shiseido Women s 0 52oz sold at 72.99 $ ; this product is listed in the Face Care category, produced by Shiseido, and sold by Gilt.com.
Vital Perfection Uplifting and Firming Eye Cream 052oz Measures approximately 330in x 356in x 1194in Suitable for normal skin types Experience visibly lifted skin in just 1 week This scientifically advanced silky moisturizer helps visibly offset the effects of aging in record time Skin feels firm and sculpted with renewed fullness and bounce Use in the morning and evening apply one pump to clean skin around the eye area In the morning use before SPF or makeup that contains sun protection In the evening Dot onto skin and gently smooth in using gentle sweeping motions from the inner corner to the temples Use as the last step of your skincare routine Ingredients Water Aqua Pentaerythrityl Tetraethylhexanoate Squalane Butylene Glycol Glycerin Dipropylene Glycol Behenyl Alcohol Dimethicone Diphenylsiloxy Phenyl Trimethicone Myristyl Myristate Potassium Methoxysalicylate Hydrogenated Polyisobutene Stearyl Alcohol Beheneth20 Peg400 Phenoxyethanol Hydrogenated Palm Oil DimethiconePhenyl Vinyl Dimethicone Crosspolymer DimethylacrylamideSodium Acryloyldimethyltaurate Crosspolymer Elaeis Guineensis Palm Kernel Oil Polyvinyl Alcohol Elaeis Guineensis Palm Oil Fragrance Parfum Disodium Edta Rosa Damascena Flower Water Tocopheryl Acetate Xanthan Gum Retinyl Acetate Sodium Citrate Helianthus Annuus Sunflower Seed Oil Bht Alcohol Caffeine Lavandula Angustifolia Lavender Oil Sodium Metabisulfite Citric Acid Sodium Metaphosphate Ppg3 Dipivalate Tocopherol Iron Oxides Ci 77492 Sodium Acetylated Hyaluronate Angelica Acutiloba Root Extract Angelica Keiskei LeafStem Extract Iron Oxides Ci 77491 Olea Europaea Olive Leaf Extract Sanguisorba Officinalis Root Extract Lamium Album FlowerLeafStem Extract Camellia Sinensis Leaf Extract Carthamus Tinctorius Safflower Flower Extract Inositol Pinus Sylvestris Cone Extract Ziziphus Jujuba Fruit Extract Rosmarinus Officinalis Rosemary Leaf Extract Rosmarinus Officinalis Eucheuma SerraGrateloupia SparsaSaccharina AngustataUlva LinzaUndaria Pinnatifida Extract Saccharina AngustataUndaria Pinnatifida Extract Bupleurum Falcatum Root Extract Coix LacrymaJobi MaYuen Seed Extract Cellulose This product is not tested on animals Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Face Cream CLNQSMRTCLNCLRPRWRKLCRCTGCRM 25OZBenefitsAll Skin TypesAntiwrinkle face cream strengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydration which helps minimize the appearance of fine dry linesAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleSafe for sensitive skinAllergy TestedFragrance freeKey IngredientsPowered by peptides this antiwrinkle face cream helps strengthen skin and visibly repair lines and wrinklesCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinLeveraging Cliniques 35 years of peptide expertise formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research ResultsSensory testing applies only to the Cream formula for All Skin TypesAfter 1 use 91 of 148 women say skin looks smoother and feels firmerAfter 1 week95 of 148 women say skin feels hydrated throughout the day95 say skin feels hydrated throughout the nightAfter 4 weeks92 of 146 women say skin feels firmer92 of 146 women say skin looks smoother93 of 146 women say neck feels smoother94 of 146 women say skin looks healthier85 of 143 women say lines and wrinkles look reduced Clinique Smart Clinical Repair Wrinkle Correcting Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125120
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting sold for 106 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Smart Clinical Repair Lifting Face Neck Cream SMART CLINICAL REPR MCRO LIFT CRM 75SZBenefitsAll Skin TypesClinically proven to visibly lift skin on face and neck visibly reduce lines and wrinkles and smooth neck crepinessFormulated with multipeptides to help boost skins natural collagen production to help boost skins strengthSkin looks smoother and more lifted and feels firmerPlumps with instant and longlasting hydrationDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeKey IngredientsMultipeptides Support skins strength which helps skin look more lifted and lines and wrinkles look reducedHyaluronic acid jojoba oil and shea butter Blend of moisturizing ingredients helps hydrate restore suppleness and visibly smooth fine dry linesResearch Results100 show a more liftedlooking face and neck100 show a less crepeylooking neckClinical testing on 36 women after using the product for 12 weeks Smart Clinical Repair Lifting Face Neck Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333228272
Find tips, reviews, and features on SUR MEDIC Perfection 100tm All sold for 40.95 $ , available in the Face Care category; this product belongs to SUR.MEDIC+ and is sold by Sokoglam.com.
Shop this eye cream by skin care brand SURMEDIC a luxurious and powerful total care cream for your eyes and face that hydrates plumps and brightens
Condition: new
Disponibility: in_stock
Shipping: 6.95
Explore tips, opinions, and features on Acqua di Parma Barbiere M sold at 83.99 $ ; this product is listed in the Face Care category, produced by Acqua di Parma, and sold by Palmbeachperfumes.com.
Barbiere By Acqua di Parma For Men Moisturizing Face Cream 17oz NEW
Condition: new
Disponibility: in_stock
Delivery Time: 2-8 business days
EAN: 8028713520075
