Discover information, advice, and prices for Cellapy A Repair Cream Body, priced at 41.7 $ : it belongs to the Body Care category; this product is sold by Yesstyle.com and made by Cellapy.
Brand from South Korea Cellapy BenefitsA pHbalanced body wash for healthy and revitalized skinEnriched with Sodium Hyaluronate Panthenol and Ceramide NP to provide intensive moisture and nourishment for dry and sensitive skin leaving your skin smooth and clean after showerFeatures the ARepair Peptide for calming irritated skin while strengthening skin barriers to prevent dehydrationFormulated with a slightly acidic pH level of 55Completed skin irritation test and suitable for all skin typesHow to use1 Lather up the body wash and gently massage on skin in shower2 Rise off thoroughly with lukewarm water
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 8809386604114
Discover information, advice, and prices for Cellapy A Repair Body Lotion sold for 46.1 $ , available in the Body Care category; this product is sold by Yesstyle.com and made by Cellapy.
Brand from South Korea Cellapy BenefitsA mildly formulated body lotion that delivers intensive moisture and is safe for all skin typesThe ARepair Peptide effectively calms irritated skin while fortifying the barrier of damaged skin to improve skin conditionProvides longlasting moisturizing power that even hydrates under deep skin layers to create glowing and plump skinHypoallergenic tested and suitable for sensitive skinHow to useAfter showering dispense a moderate amount and apply over the entire body
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 8809386604107
Explore tips, opinions, and features on Kose Dr Phil Cosmetics X sold at 30.48 $ ; this product is listed in the Body Care category, produced by Kose, and sold by Yesstyle.com.
Brand from Japan Kose Contains Sakuran TM a natural polymer that forms a pseudobarrier filmIt boasts an amazing water retention capacity that is said to be five times that of hyaluronic acid and firmly prevents the evaporation of water from the skinProtects weak barrier skin from external stimuli such as dust and dirt in the airContains moisturizing barrier ingredients that restore weak barrier skinIt approaches the sebum barrier layer and stratum corneum barrier layer by giving full moisture to the dry and prone bodyComfortable to use without feeling a burden on the skinIt spreads smoothly on the skin that tends to be rough and realizes a feeling of use that does not make you feel a burdenA moist and supple protective film that blends well with the skin and lasts for a long timeHypoallergenic prescription that cares for weak barrier skinFragrancefree colorfree parabenfree alcohol ethyl alcohol freeHow to useTake an appropriate amount on the palm and apply it gent
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 4562133471448
Explore tips, opinions, and features on NIVEA Repair Care Body Cream sold at 32.5 $ ; this product is listed in the Vitamins & Supplements category, produced by NIVEA, and sold by Yesstyle.com.
Brand from Germany NIVEA Cream with Dexpanthenol Urea72h relief from dry tight skinFormula infused with Deep Moisture Serum and dexpanthenolUsed regularly it gives you a comfortable skin feeling relieving it from tightness for 72hIt immediately soothes rough dry skin and instantly calms irritated areas after just 1 applicationHow to useApply the body cream all over body and gently massage into the skin using small upward circular strokesCan apply extra amount for extra dry and rough areas
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 4005900463074
Discover information, advice, and prices for Sabon Repair Body Cream Cosmetics, priced at 70.6 $ : it belongs to the Body Care category; this product is sold by Yesstyle.com and made by Sabon.
Brand from Israel Sabon This rich but lightweight cream highly concentrated in Shea butter intensely nourishes your skin protects and repairs skins drynessIt is specially designed for dry to very dry skin with unique and deep repairing action to renew the skin and recover its elasticityThe unique formula is vegan 85 natural origin Paraben and Mineral oil free and enriched with deep nourishing Shea Butter moisturizing Rose of Jericho and Canola oils for extra nourishing benefitsIts rich texture sinks quickly into the skin and leaves it soft supple and smooth without any greasy residueHow to useApply once or twice a day by massaging until fully absorbedMassage into your skin using circular movements paying particular attention to dry and rough areas elbows knees heelsBeauty secret Exfoliate you skin with our Body Scrub before applying Repair Body CreamIt will maximize its repairing efficiency
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting sold for 82 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 17oz50ml
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Sol de Janeiro Brazilian Bum sold for 30.95 $ , available in the Body Care category; this product belongs to Sol de Janeiro and is sold by Ulta.com.
Brazilian Bum Bum Refillable Body Cream BUM BUM CREAM 25OZBenefitsThe iconic fastabsorbing body cream helps visibly tighten and smooth skin with potent caffeinerich guaranCupuau butter locks in lasting nongreasy hydrationCoconut oil softens conditions and replenishes moistureFeaturesScented with the irresistible Cheirosa 62 fragrance with notes of pistachio and salted caramelFragrance NotesTop Pistachio AlmondMid Heliotrope Jasmine PetalsDry Vanilla Salted Caramel SandalwoodRefill pods provide the same amount of the body cream with 89 less plasticVeganSustainably SourcedCruelty FreeFormulated WithoutGlutenParabensPhthalatesTalcSulfatesMineral oilMicrobeadsSoyArtificial ColorantsPEGs Brazilian Bum Bum Refillable Body Cream
Condition: new
Disponibility: in_stock
Shipping: 6.95
Delivery Time: 3-8 Business Days
EAN: 0810912032040
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 99 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Our antiaging eye cream for wrinkles helps strengthen delicate eyearea skin making it smoother brighter and youngerlooking Helps visibly depuff eyes too 100 feel a smoother eye area Dermatologist tested Safe for sensitive eyes and contact lens wearers Safe for sensitive skin around eyes Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Eye Cream 1oz30ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 77 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Wrinklefighting cream helps strengthen and nourish for smoother youngerlooking skin Please Note 15ml size is excluded from additional discounts Clinique Smart Clinical Repair trade Wrinkle Correcting Rich Cream 17oz50ml
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Smart Clinical Repair Lifting sold for 106 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 25oz75ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Our antiaging cream helps strengthen skin and visibly repair lines and wrinkles 92 say skin looks smoother and feels firmer Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Cream 17oz50ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on First Aid Beauty Ultra Repair sold at 36.95 $ ; this product is listed in the Body Care category, produced by First Aid Beauty, and sold by Ulta.com.
Ultra Repair Cream JUMBO ULTRA REPAIR CREAM 120OZBenefitsTreats eczema speeds up skin renewal to strengthen surface barrier for longterm reliefSkin feels comfortable after just one use24 hours of soothing hydrationMade with Colloidal Oatmeal a skin protectant and barrierbuilding ingredientSafe for sensitive skin and good for face bodyKey IngredientsColloidal Oatmeal Treats eczema improves skin renewal for stronger skin barrierShea Butter Moisturizes and protects the skin barrierAllantoin Calms and soothes skinFormulated WithoutFragranceParabensSulfatesMineral Oil Ultra Repair Cream
Condition: new
Disponibility: in_stock
Shipping: 6.95
Delivery Time: 3-8 Business Days
EAN: 0851939002104
Explore tips, opinions, and features on First Aid Beauty Ultra Repair sold at 48 $ ; this product is listed in the Body Care category, produced by First Aid Beauty, and sold by Ulta.com.
Ultra Repair Cream ULTRA REPAIR CREAM JUMBO 80OZBenefitsAwardwinning rich hydrating formula quickly absorbs with no greasy afterfeelSkin feels comfortable after just one use24 hours of soothing hydrationTreats eczema speeds up skin renewal to strengthen surface barrier for longterm reliefMade with Colloidal Oatmeal a skin protectant and barrierbuilding ingredientSafe for sensitive skin and good for face bodyKey IngredientsColloidal Oatmeal OTC Treats eczema improves skin renewal for stronger skin barrierShea Butter Moisturizes and protects the skin barrierAllantoin Calms and soothes skinResearch ResultsClinically proven to strengthen skin barrier in 7 daysIn an independent clinical study with 21 participantsMore than 2x immediate increase in skin hydrationIn a consumer perception study with 21 participants after 2 weeks100 reported the product helped soothe moisturize and condition skin Ultra Repair Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0852575005849
Discover information, advice, and prices for Neutrogena Rapid Wrinkle Repair Regenerating sold for 37.99 $ , available in the Face Care category; this product is sold by Ulta.com and made by Neutrogena.
Rapid Wrinkle Repair Regenerating Cream RAPID WRINKLE REPAIR CREAM FFBenefitsRetinol cream fades the look of deep wrinkles even crows feet and forehead and cheek wrinklesMoisturizer with purified hyaluronic acid which smooths the look of fine lines plumps skinAntiwrinkle cream contains Accelerated Retinol SA and Glucose Complex for rapid effective resultsMoisturizer reduces the look of skin aging 5 times more than a leading prestige antiwrinkle productFragrancefree retinol moisturizer from a dermatologistrecommended skin care brandKey IngredientsDelivers the highest concentration of Accelerated Retinol SA deep into skins surface quickly and effectivelyGlucose Complex acts as a Retinol SA booster to accelerate skins surface activity for rapid resultsHyaluronic acid adds line plumping moisture to help hydrate replenish and rejuvenate the look of your skinResearch ResultsVisibly smoother and youngerlooking skin in just one week Rapid Wrinkle Repair Regenerating Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0070501111079
Find tips, reviews, and features on Clinique Smart Clinical Repair Lifting sold for 82 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Smart Clinical Repair Lifting Face Neck Cream SMART CLINICAL REPAIR MICRO LIFT CREAMBenefitsAll Skin TypesClinically proven to visibly lift skin on face and neck visibly reduce lines and wrinkles and smooth neck crepinessFormulated with multipeptides to help boost skins natural collagen production to help boost skins strengthSkin looks smoother and more lifted and feels firmerPlumps with instant and longlasting hydrationBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeNonacnegenicFree of Fragrance Parabens Phthalates Sodium lauryl sulfate Sodium laureth sulfate synthetic colors drying alcoholKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinMultipeptides Support skins strength which helps skin look more lifted and lines and wrinkles look reducedHyaluronic acid jojoba oil and shea butter Blend of moisturizing ingredients helps hydrate restore suppleness and visibly smooth fine dry linesDaily moisturizer for face and neck supports skins strength which helps skin look more lifted and lines and wrinkles look reduced The formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research Results100 show a more liftedlooking face and neck100 show a less crepeylooking neckPercentage of women in an index combining improvement in neck jawline and cheek sagging clinical testing on 36 women after using product for 12 weeks97 show visibly reduced crows feet lines97 show visibly reduced lines and wrinkles on neckClinical testing on 36 women after using the product for 12 weeks Smart Clinical Repair Lifting Face Neck Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333144756
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 65 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Eye Cream SMART CLINICAL 360 EYE CREAM 004OZBenefitsAll Skin TypesThe skin around the eyes is delicate and susceptible to damage Cliniques Wrinklefighting eye cream is engineered to fortify this skin making it stronger visibly smoother and more resilientHelps visibly smooth lines and wrinkles and strengthen skin from multiple angles boosts skins natural collagen helps support skins natural structure strengthens skins moisture barrierReduces the appearance of line and wrinkles caused by your faces daily micromovementsEye cream delivers instant and longlasting smoothing hydrationVisibly calms and soothes skin plus instantly brightensHelps instantly depuff eye area by gently massaging into skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinOphthalmologist tested Safe for sensitive eyes and contact lens wearersNo parabens No phthalates Allergy tested 100 fragrance freeMore responsible packaging 15ml is packed in a recyclable glass jarTo recycle the jar remove the cap then rinse the jar and place in a recycling binCarton is made from FSCcertified paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureSigesbeckia orientalis extract A powerful procollagen extract prized for helping skin maintain its natural densityHyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesResearch ResultsSensory testing after 4 weeks85 say crows feet look reduced86 say undereye lines look reducedIn a clinical test on 36 women after using the product for 12 weeks100 show a more liftedlooking face and neck100 show a less crepeylooking neckIn 1 week of consumer testing on 156 women94 say eye area looks smoother90 say eye area feels firmerIn 12 weeks92 say eye area looks brighter100 feel a smoother eye area90 say eye area looks younger20 reduction in the look of undereye puffiness25 improvement in the appearance of overall tear troughClinical testing on 32 women after using the product for 12 weeksClinical testing on 48 women after using the product for 12 weeks Clinique Smart Clinical Repair Wrinkle Correcting Eye Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333102749
Discover information, advice, and prices for VEVOR Stud Welder Dent Repair, priced at 189.99 $ : it belongs to the Power Tools category; this product is sold by Homedepot.com and made by VEVOR.
VEVOR 800Watt Stud Spot Welder Perfect Welds in Every Spot Elevate your automotive dent repair with the VEVOR 800Watt stud spot welder Its precision welding prowess userfriendly operation versatile applications enhanced safety features and allinclusive professional package make it the ultimate solution for seamless and efficient dent repair
Condition: new
Disponibility: in_stock
EAN: 0197988475866
Discover information, advice, and prices for Clinique Smart Clinical Repair Overnight sold for 80 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Smart Clinical Repair Overnight Recovery Face Cream Mask SMRT CLNCL RPR VRNT RCVRY CRM MSKBenefitsHelps restore your skin barrier which is naturally weaker at night A weaker barrier makes skin more susceptible to external factors which makes it more prone to sensitivityOptimizes skins natural nightly repair process visibly reducing lines and wrinkles and soothing the look of sensitivityPlumps and reduces fine dry lines overnightVisibly corrects wrinkles smooths skin and boosts radiance over timeDelivers rich deep hydrationDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeKey IngredientsAdenosine Naturally occurring nocturnal biomolecule helps visibly quell irritation turning down or soothing sensitivityPeptides Help boost skins strength for a smoother appearance Formula includes neuropeptide and signaling peptides Palmitoyl tripeptide1 Acetyl hexapeptide8 Palmitoyl tetrapeptide712 hyaluronic acid solution Helps hydrate to visibly smooth fine dry linesResearch ResultsOvernightSkin is hydrated feels soothed and skin barrier is strengthenedIn 1 weekCrows feet forehead lines nasolabial folds and neck lines are visibly reducedIn 2 weeks97 show reduced facial lines92 say skin looks healthier94 say skin looks smoother92 say skin looks radiantClinical testing on 33 women after using the product for 1 weekFacial lines refers to crows feet lines Clinical testing on 33 women after using the product for 2 weeksConsumer testing on 132 women after using the product for 2 weeks Smart Clinical Repair Overnight Recovery Face Cream Mask
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333232392
Discover information, advice, and prices for JONES STEPHENS 4 in IPS sold for 90.56 $ , available in the Plumbing category; this product is sold by Homedepot.com and made by Jones Stephens.
The Jones Stephens Malleable Iron Compression Coupling is galvanized for corrosion protection You can depend on this coupling to make a longlasting connection of 2 water pipes It features EPDM gaskets and a metal friction ring This coupling has a long pattern design and fits both IPS and Schedule 40 pipe Color Silver
Condition: new
Disponibility: in_stock
EAN: 0717510114003
