Discover information, advice, and prices for Clinique Repairwear Laser Focus Wrinkle, priced at 65 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Repairwear Laser Focus Wrinkle Correcting Eye Cream RWLF WRINKLE CORRECTNG EYE 05OZBenefitsSee your entire eye area visibly improveDeaging formula plumps and moisturizesLeaves eyes looking younger and more radiantDermatologist and ophthalmologist testedAllergy testedFormulated WithoutParabensPhthalatesFragrance Repairwear Laser Focus Wrinkle Correcting Eye Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0020714777647
Discover information, advice, and prices for Clinique 1 7oz Repairwear Laser, priced at 49.99 $ : it belongs to the Make up category; this product is sold by Gilt.com and made by Clinique.
Repairwear Laser Focus Line Smoothing Cream SPF 15 17oz Suitable for all skin types Repairwear Laser Focus Line Smoothing Cream SPF 15 is deaging moisturizer with SPF reduces the appearance of lines and wrinkles With daily use lines and wrinkles seem to evaporate replaced by plump vibrant skin Active ingredients Water Aqua Eau Neopentyl Glycol Diheptanoate Simmondsia Chinensis Jojoba Butter Glycerin Petrolatum Octyldodecyl Neopentanoate DiC1215 Alkyl Fumarate Dimethicone Hydrogenated Lecithin Butylene Glycol Hydrogenated Polyisobutene Pentaerythrityl Tetraethylhexanoate Hexyldecyl Stearate Polyethylene Pentylene Glycol Potato Starch Modified Citrus Reticulata Tangerine Peel Extract This product is not tested on animals Made in the UK All items for external use only
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Repairwear Laser Focus Wrinkle sold at 99 $ ; this product is listed in the Body Care category, produced by Clinique, and sold by Clinique.com.
Rich eye cream plumps hydrates and diminishes the look of fine lines Leaves eyes looking more radiant Clinique Repairwear Laser Focus trade Wrinkle Correcting Eye Cream 30 ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Repairwear Intensive Lip Treatment, priced at 41.95 $ : it belongs to the Make up category; this product is sold by Ulta.com and made by Clinique.
Repairwear Intensive Lip Treatment REPAIRWEAR INTENSIVE LIP TRTMT 014OZBenefitsAntioxidantinfused formula replenishes moisture so lips stay soft and hydratedDermatologist testedAllergy testedFormulated WithoutParabensPhthalatesDenatured alcoholSLSSLESFragrance Repairwear Intensive Lip Treatment
Condition: new
Disponibility: in_stock
Shipping: 6.95
Delivery Time: 3-8 Business Days
EAN: 0020714233907
Discover information, advice, and prices for Clinique 1 7oz Repairwear Laser sold for 52.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Clinique.
Repairwear Laser Focus Line Smoother 17oz A daily moisturizer with visible effects Lines and wrinkles seem to evaporate replaced by plump vibrant skin alive with collagen and elastin Skin gains strength over environmental agers Looks younger longer Active ingredients Aqua butyrosperhum parkii capryliccapric triglyceride butylene glycol parfum cetearyl alcohol glycerin glyceryl stearate peg100 stearate dinethiecone xylitol triethylhexanoin ceteareth22 phenoxyethanol ethylhexyl methoxycinnamate butyl methoxydibenzoylmethane caprylyl glycol carbomer tocopheryl acetate disodium edta xanthan gum butylphenyl methylpropional sodimum hydroxide This product is not tested on animals Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 108 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 17oz50ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 80 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 1oz30ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 99 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Our antiaging eye cream for wrinkles helps strengthen delicate eyearea skin making it smoother brighter and youngerlooking Helps visibly depuff eyes too 100 feel a smoother eye area Dermatologist tested Safe for sensitive eyes and contact lens wearers Safe for sensitive skin around eyes Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Eye Cream 1oz30ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Unisex 1 7oz Repairwear sold at 64.99 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Gilt.com.
A light richly moisturizing cream that visibly tightens lifts and firms skin It is great for all dry combination to combination and oily types of skin it supports natural elasticity Help skin appear smoother and more lifted Apply after your threestep skincare routine apply to face and throat or where needed for best results partner with repairwear laser focus Ingredients Commiphora mukul resin extract litchi chinensis seed extract laminaria digitata extract cladosiphon okamuranus extract and plankton extract Imported
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 77 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Wrinklefighting cream helps strengthen and nourish for smoother youngerlooking skin Please Note 15ml size is excluded from additional discounts Clinique Smart Clinical Repair trade Wrinkle Correcting Rich Cream 17oz50ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Our antiaging cream helps strengthen skin and visibly repair lines and wrinkles 92 say skin looks smoother and feels firmer Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Cream 17oz50ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 65 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Eye Cream SMART CLINICAL 360 EYE CREAM 004OZBenefitsAll Skin TypesThe skin around the eyes is delicate and susceptible to damage Cliniques Wrinklefighting eye cream is engineered to fortify this skin making it stronger visibly smoother and more resilientHelps visibly smooth lines and wrinkles and strengthen skin from multiple angles boosts skins natural collagen helps support skins natural structure strengthens skins moisture barrierReduces the appearance of line and wrinkles caused by your faces daily micromovementsEye cream delivers instant and longlasting smoothing hydrationVisibly calms and soothes skin plus instantly brightensHelps instantly depuff eye area by gently massaging into skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinOphthalmologist tested Safe for sensitive eyes and contact lens wearersNo parabens No phthalates Allergy tested 100 fragrance freeMore responsible packaging 15ml is packed in a recyclable glass jarTo recycle the jar remove the cap then rinse the jar and place in a recycling binCarton is made from FSCcertified paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureSigesbeckia orientalis extract A powerful procollagen extract prized for helping skin maintain its natural densityHyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesResearch ResultsSensory testing after 4 weeks85 say crows feet look reduced86 say undereye lines look reducedIn a clinical test on 36 women after using the product for 12 weeks100 show a more liftedlooking face and neck100 show a less crepeylooking neckIn 1 week of consumer testing on 156 women94 say eye area looks smoother90 say eye area feels firmerIn 12 weeks92 say eye area looks brighter100 feel a smoother eye area90 say eye area looks younger20 reduction in the look of undereye puffiness25 improvement in the appearance of overall tear troughClinical testing on 32 women after using the product for 12 weeksClinical testing on 48 women after using the product for 12 weeks Clinique Smart Clinical Repair Wrinkle Correcting Eye Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333102749
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 192 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Serum F21CLNQSMRTCLNCLRPRWRKLCRCTGSRM 1OZBenefitsAll Skin TypesThe trailblazer of Cliniques most advanced deaging line Clinique Smart Clinical RepairDesigned with an expert panel of scientists and Cliniques consulting dermatologistsCuttingedge formula is superconcentrated with antiaging specialists including Cliniques expert peptiderich blend CL1870 Laser Focus ComplexTargets a full range of lines and wrinkles attacking from three separate anglesRepairs Boosts natural collagen with CL1870 Laser Focus ComplexResurfaces Smooths skin with potent retinoidReplumps Hydrates fine wrinkles with hyaluronic acidSkin is visibly rejuvenated smoother and more supple to the touch a more youthful radiance and bounce is restoredFragrancefree Oilfree SLSfree SLESfree Sulfatesfree free of denatured alcoholAllergy tested 100 fragrance freeKey IngredientsCL1870 Laser Focus Complex An expert blend of peptides and optimizing ingredients designed to help boost the skins natural collagen production for a smoother appearanceCL1870 Laser Focus Complex includes Palmitoyl tripeptide1 Acetyl hexapeptide8 Palmitoyl tetrapeptide7 and an optimizing blend of caffeine and algae extract to help minimize irritationPotent retinoid The next generation of retinol formulated for highperformance deaging effects with a gentle touch Helps accelerates skins natural cell renewal to speed fresh skin cells to the surface Helps shed dull surface skin to visibly reduce wrinklesHyaluronic acid concentrate Instantly hydrates and plumps skin Helps restores suppleness and volume to diminish the appearance of fine dry linesResearch ResultsClinical TestingAs effective as one laser treatment on the look of lines and wrinkles after 16 weeksIn a clinical study after 16 weeks women who had one laser treatment showed the same improvement in the overall look of lines and wrinkles as those who used Smart Serum twice daily instead Laser used microablative deka dot SmartSkin CO2 Cynosure Westford MA with CO2 fractional techAlso in 10 days84 say deeper wrinkles look reduced94 say skin feels smoother87 say skin feels more plumped92 agree its gentle and nonirritatingConsumer testing on 358 women Clinique Smart Clinical Repair Wrinkle Correcting Serum
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333101698
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 26 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 033oz10ml
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 192 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 34oz100ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 77 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
Discover information, advice, and prices for Clinique Women s 1oz Smart sold for 79.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Clinique.
Smart Clinical Repair Wrinkle Correcting Serum 1oz Suitable for very dry to dry dry combination combination oily oily Use this face serum for antiaging twice a day morning and night Step 1 Dispense 1 to 2 pumps onto fingertips Step 2 Spread all over clean face and neck avoiding eye area Step 3 Follow with your favorite Clinique Smart Clinical Repair moisturizer Ingredients WaterAquaEau Dimethicone Isododecane Butylene Glycol Glycerin Polysilicone11 Ascorbyl Glucoside Sodium Hyaluronate Tocopheryl Acetate Squalane Hypnea Musciformis Algae Extract Gelidiella Acerosa Extract Sigesbeckia Orientalis St PaulS Wort Extract Helianthus Annuus Sunflower Seed Extract Hordeum Vulgare Barley ExtractExtrait DOrge Triticum Vulgare Wheat Germ Extract Cucumis Sativus Cucumber Fruit Extract Caffeine Acetyl Hexapeptide8 Palmitoyl Tripeptide1 Palmitoyl Tetrapeptide7 Palmitoyl Hexapeptide12 Peg10 Dimethicone Glycyrrhetinic Acid Whey ProteinLactis ProteinProteine Du PetitLait Isohexadecane Propylene Glycol Dicaprate Caprylyl Glycol Hydroxypinacolone Retinoate Acetyl Glucosamine Cholesterol Peg8 Yeast ExtractFaexExtrait De Levure Peg6 Dimethyl Isosorbide Glyceryl Polymethacrylate Polysorbate 20 Sodium Phosphate Synthetic Fluorphlogopite Polysorbate 80 Carbomer Hexylene Glycol Ammonium AcryloyldimethyltaurateVp Copolymer AcrylamideSodium Acryloyldimethyltaurate Copolymer Potassium Hydroxide Tin Oxide Disodium Phosphate Citric Acid Disodium Edta Sodium Citrate Phenoxyethanol Potassium Sorbate Titanium Dioxide Ci 77891 This product is not tested on animals This product is parabenfree All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Women s 1 7oz, priced at 39 $ : it belongs to the Face Care category; this product is sold by Gilt.com and made by Clinique.
Smart Clinical Repair Wrinkle Correcting Serum 17oz Measures approximately 166in x 166in x 612in Suitable for all skin types Use this hydrating face moisturizer morning and night on face and neck Always include SPF as the last step in the morning Ingredients Water Aquaneau DimethIcone Isododecane Butylene Glycol Glycerin Polysilicone11 Ascorbyl Glucoside Sodium Hyaluronate ToCopheryl Acetate Squalane Hypnea Musciformis Algae Extract Gelidiella Acerosa Extract Sigesbeckia Orientalis St PaulS Wort Extract Helianthus Annuus Sunflower Seed Extract Hordeum Vulgare Barley Extracti Extrait DOrge Triticum Vulgare Wheat Germ Extract Cucumis Sativus CuCumber Fruit Extract Caffeine Acetyl Hexapeptide8 Palmitoyl Tripeptide1 Palmitoyl Tetrapeptide7 Palmitoyl Hexapeptide12 Peg10 Dimethicone Glycyrrhetinic Acid Whey Protein Lactis ProteinProteine Du PetitLait IsohexAdecane Propylene Glycol Dicaprate Caprylyl Glycol Hydroxypinacolone Retinoate Acetyl Glucosamine Cholesterol Peg8 Yeast Extract Faex Extrait De Levure Peg6 Dimethyl IsoSorbide Glyceryl Polymethacrylate Polysorbate 20 Sodium Phosphate Synthetic Fluorphlogopite Polysorbate 80 Carbomer Hexylene Glycol Ammonium AcryloyldimethyltaurateVp Copolymer AcrylamideSodium AcrylOyldimethyltauratecopolymer Potassium Hydroxide Tin Oxide DisoDium Phosphate Citric Acid Disodium Edta Sodium Citrate Phenoxyethanol Potassium Sorbate Titanium Dioxide Ci 77891 Iln49151 This product is not tested on animals This product is noncomedogenic This product is parabenfree Made in Canada All items for external use only
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Face Cream CLNQSMRTCLNCLRPRWRKLCRCTGCRM 25OZBenefitsAll Skin TypesAntiwrinkle face cream strengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydration which helps minimize the appearance of fine dry linesAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleSafe for sensitive skinAllergy TestedFragrance freeKey IngredientsPowered by peptides this antiwrinkle face cream helps strengthen skin and visibly repair lines and wrinklesCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinLeveraging Cliniques 35 years of peptide expertise formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research ResultsSensory testing applies only to the Cream formula for All Skin TypesAfter 1 use 91 of 148 women say skin looks smoother and feels firmerAfter 1 week95 of 148 women say skin feels hydrated throughout the day95 say skin feels hydrated throughout the nightAfter 4 weeks92 of 146 women say skin feels firmer92 of 146 women say skin looks smoother93 of 146 women say neck feels smoother94 of 146 women say skin looks healthier85 of 143 women say lines and wrinkles look reduced Clinique Smart Clinical Repair Wrinkle Correcting Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125120
Find tips, reviews, and features on Clinique Repairwear Uplifting Firming Cream sold for 77 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Light yet rich moisturizing cream helps visibly tighten lift and firm the face and neck Protects with SPF Clinique Repairwear trade Uplifting Firming Cream Broad Spectrum SPF 15 17oz50ml to
Condition: new
Disponibility: in_stock