Discover information, advice, and prices for Clinique Smart Clinical Repair Broad, priced at 77 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Dermalactive SPF 30 formula visibly repairs wrinkles protects with SPF 30 and helps prevent future damage Clinique Smart Clinical Repair trade Broad Spectrum SPF 30 Wrinkle Correcting Cream 17oz50ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting, priced at 82 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 17oz50ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 108 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 17oz50ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Smart Clinical Repair Wrinkle sold at 80 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 1oz30ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 99 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Our antiaging eye cream for wrinkles helps strengthen delicate eyearea skin making it smoother brighter and youngerlooking Helps visibly depuff eyes too 100 feel a smoother eye area Dermatologist tested Safe for sensitive eyes and contact lens wearers Safe for sensitive skin around eyes Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Eye Cream 1oz30ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Even Better Makeup Broad, priced at 39 $ : it belongs to the Make up category; this product is sold by Ulta.com and made by Clinique.
Even Better Makeup Broad Spectrum SPF 15 Foundation VN BTR MKP BRD SPTRM SPF 15 CN40CRMCHMSBenefitsSkin Types Dry Combination Combination OilyDermatologistdeveloped formula with vitamin C Visibly reduces dark spots after 12 weeks of daily useBroad Spectrum SPF 15 helps protect against future discolorationCreamy formula hydrates and smooths and gives skin a natural finish with moderate coverageStaytrue pigments wont change color on your skinBuilt with BetterFlex Technology a special blend of polymers that helps give this foundation flexibility so it moves when you move and smiles when you smileDermatologist testedOphthalmologist testedAllergy tested 100 fragrance freeKey IngredientsVitamin CBroad Spectrum SPF 56Research ResultsDermatologistdeveloped liquid foundation visibly reduces dark spots in 12 weeksClinical testing conducted on 22 women after using product for 12 weeks91 say color stays true all day90 say skin feels comfortable all day90 say it feels weightless on skinConsumer testing on 546 women after using product for 2 weeks Even Better Makeup Broad Spectrum SPF 15 Foundation
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0020714324636
Discover information, advice, and prices for Clinique Even Better Makeup Broad, priced at 39 $ : it belongs to the Make up category; this product is sold by Ulta.com and made by Clinique.
Even Better Makeup Broad Spectrum SPF 15 Foundation VN BTR MKP BRD SPTRM SPF 15 CN 52 NTRLBenefitsSkin Types Dry Combination Combination OilyDermatologistdeveloped formula with vitamin C Visibly reduces dark spots after 12 weeks of daily useBroad Spectrum SPF 15 helps protect against future discolorationCreamy formula hydrates and smooths and gives skin a natural finish with moderate coverageStaytrue pigments wont change color on your skinBuilt with BetterFlex Technology a special blend of polymers that helps give this foundation flexibility so it moves when you move and smiles when you smileDermatologist testedOphthalmologist testedAllergy tested 100 fragrance freeKey IngredientsVitamin CBroad Spectrum SPF 60Research ResultsDermatologistdeveloped liquid foundation visibly reduces dark spots in 12 weeksClinical testing conducted on 22 women after using product for 12 weeks91 say color stays true all day90 say skin feels comfortable all day90 say it feels weightless on skinConsumer testing on 546 women after using product for 2 weeks Even Better Makeup Broad Spectrum SPF 15 Foundation
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0020714324643
Explore tips, opinions, and features on Clinique Smart Clinical Repair AM sold at 35 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Clinique.com.
Targeted retinoid treatment that instantly softens and plumps fine dry lines and targets deeper ones over time too Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Please note This product is excluded from discounts Clinique Smart Clinical Repair trade AMPM Retinoid Balm 01oz3g
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Wrinklefighting cream helps strengthen and nourish for smoother youngerlooking skin Please Note 15ml size is excluded from additional discounts Clinique Smart Clinical Repair trade Wrinkle Correcting Rich Cream 17oz50ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Broad, priced at 100 $ : it belongs to the Body Care category; this product is sold by Clinique.com and made by Clinique.
Dermalactive SPF 30 formula visibly repairs wrinkles protects with SPF 30 and helps prevent future damage Clinique Smart Clinical Repair trade Broad Spectrum SPF 30 Wrinkle Correcting Cream 25oz75ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting sold for 106 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Powerful face and neck cream visibly lifts and reduces the look of lines and wrinkles 100 show a more liftedlooking face and neck Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Lifting Face Neck Cream 25oz75ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 77 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Our antiaging cream helps strengthen skin and visibly repair lines and wrinkles 92 say skin looks smoother and feels firmer Dermatologist tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Cream 17oz50ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 65 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Eye Cream SMART CLINICAL 360 EYE CREAM 004OZBenefitsAll Skin TypesThe skin around the eyes is delicate and susceptible to damage Cliniques Wrinklefighting eye cream is engineered to fortify this skin making it stronger visibly smoother and more resilientHelps visibly smooth lines and wrinkles and strengthen skin from multiple angles boosts skins natural collagen helps support skins natural structure strengthens skins moisture barrierReduces the appearance of line and wrinkles caused by your faces daily micromovementsEye cream delivers instant and longlasting smoothing hydrationVisibly calms and soothes skin plus instantly brightensHelps instantly depuff eye area by gently massaging into skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinOphthalmologist tested Safe for sensitive eyes and contact lens wearersNo parabens No phthalates Allergy tested 100 fragrance freeMore responsible packaging 15ml is packed in a recyclable glass jarTo recycle the jar remove the cap then rinse the jar and place in a recycling binCarton is made from FSCcertified paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureSigesbeckia orientalis extract A powerful procollagen extract prized for helping skin maintain its natural densityHyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesResearch ResultsSensory testing after 4 weeks85 say crows feet look reduced86 say undereye lines look reducedIn a clinical test on 36 women after using the product for 12 weeks100 show a more liftedlooking face and neck100 show a less crepeylooking neckIn 1 week of consumer testing on 156 women94 say eye area looks smoother90 say eye area feels firmerIn 12 weeks92 say eye area looks brighter100 feel a smoother eye area90 say eye area looks younger20 reduction in the look of undereye puffiness25 improvement in the appearance of overall tear troughClinical testing on 32 women after using the product for 12 weeksClinical testing on 48 women after using the product for 12 weeks Clinique Smart Clinical Repair Wrinkle Correcting Eye Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333102749
Discover information, advice, and prices for Clinique Smart Clinical Repair Lifting sold for 82 $ , available in the Face Care category; this product is sold by Ulta.com and made by Clinique.
Smart Clinical Repair Lifting Face Neck Cream SMART CLINICAL REPAIR MICRO LIFT CREAMBenefitsAll Skin TypesClinically proven to visibly lift skin on face and neck visibly reduce lines and wrinkles and smooth neck crepinessFormulated with multipeptides to help boost skins natural collagen production to help boost skins strengthSkin looks smoother and more lifted and feels firmerPlumps with instant and longlasting hydrationBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeNonacnegenicFree of Fragrance Parabens Phthalates Sodium lauryl sulfate Sodium laureth sulfate synthetic colors drying alcoholKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinMultipeptides Support skins strength which helps skin look more lifted and lines and wrinkles look reducedHyaluronic acid jojoba oil and shea butter Blend of moisturizing ingredients helps hydrate restore suppleness and visibly smooth fine dry linesDaily moisturizer for face and neck supports skins strength which helps skin look more lifted and lines and wrinkles look reduced The formula includes selfassembly neuropeptide and signaling peptidesPalmitoyl tripeptide1Acetyl hexapeptide8Palmitoyl tetrapeptide7Palmitoyl hexapeptide12Research Results100 show a more liftedlooking face and neck100 show a less crepeylooking neckPercentage of women in an index combining improvement in neck jawline and cheek sagging clinical testing on 36 women after using product for 12 weeks97 show visibly reduced crows feet lines97 show visibly reduced lines and wrinkles on neckClinical testing on 36 women after using the product for 12 weeks Smart Clinical Repair Lifting Face Neck Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333144756
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle sold for 192 $ , available in the Face Care category; this product is sold by Clinique.com and made by Clinique.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 34oz100ml
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Clinique Smart Night Clinical MD sold at 79 $ ; this product is listed in the Face Care category, produced by Clinique, and sold by Ulta.com.
Clinique Smart Night Clinical MD MultiDimensional Repair Treatment Retinol Serum SMART NIGHT CLINIC MD RETINOL 007OZBenefitsAll Skin TypesPowered by 03 retinol this creamy formula sinks in to help speed up cell turnoverVisibly reduces fine lines and wrinklesSkin tone looks more even radiantPores look minimizedDelivers instant and lasting hydration which helps comfort skin and offset dryness sometimes associated with retinolTolerance to retinol varies by personWhat you should know about retinolRetinol is an extremely effective and powerful antiaging ingredient You may experience mild redness a warm tingling sensation or aking skin exfoliation These conditions are normal temporary indications that the formula is workingIf you experience increased discomfort when using this product revert to once every other night until skin adjusts This adjustment can take up to 4 weeksFirst time users and those with drier skin types may want to use this product every other night for more than 2 weeks to give skin additional time to adjustFor added comfort use a mild cleanser and layer an additional moisturizer over this productLimit sun exposure in general Be sure to apply a sunscreen of SPF15 or higher during the day while using this product and one week after stopping use of it Note that extreme weather conditions such as wind or cold may be more irritating so take the proper precautions to protect your faceParabenfree PhthalatefreeNo Denatured alcohol No Synthetic colorsSLSfree SLESfree SulfatefreeDermatologist testedAllergy tested FragrancefreeKey IngredientsRetinol 03 A pure form of Vitamin A its an effective antiaging ingredient known to help visibly reduce lines and wrinkles minimize the appearance of pores and smooth and refine textureYouthBoosting Blend Helps skin look smoother Includes acetyl hexapeptide8 niacinamide sigesbeckia extract and ascorbic acidComforting Hydrator Blend Helps infuse skin with hydration Includes hyaluronic acid mango seed butter wheat and barley extract coffee seed oil squalane and vitamin EResearch ResultsClinical TestingRestores radiance with 1 useMinimizes the appearance of pores in 7 daysSkin feels smoother in 28 days4 weeksImproves evenness of skin tone in 8 weeksRetexturizes skin in 12 weeksProvides instant and lasting hydrationWith continued use visibly reduces lines and wrinkles Clinique Smart Night Clinical MD MultiDimensional Repair Treatment Retinol Serum
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333054802
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 192 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Serum F21CLNQSMRTCLNCLRPRWRKLCRCTGSRM 1OZBenefitsAll Skin TypesThe trailblazer of Cliniques most advanced deaging line Clinique Smart Clinical RepairDesigned with an expert panel of scientists and Cliniques consulting dermatologistsCuttingedge formula is superconcentrated with antiaging specialists including Cliniques expert peptiderich blend CL1870 Laser Focus ComplexTargets a full range of lines and wrinkles attacking from three separate anglesRepairs Boosts natural collagen with CL1870 Laser Focus ComplexResurfaces Smooths skin with potent retinoidReplumps Hydrates fine wrinkles with hyaluronic acidSkin is visibly rejuvenated smoother and more supple to the touch a more youthful radiance and bounce is restoredFragrancefree Oilfree SLSfree SLESfree Sulfatesfree free of denatured alcoholAllergy tested 100 fragrance freeKey IngredientsCL1870 Laser Focus Complex An expert blend of peptides and optimizing ingredients designed to help boost the skins natural collagen production for a smoother appearanceCL1870 Laser Focus Complex includes Palmitoyl tripeptide1 Acetyl hexapeptide8 Palmitoyl tetrapeptide7 and an optimizing blend of caffeine and algae extract to help minimize irritationPotent retinoid The next generation of retinol formulated for highperformance deaging effects with a gentle touch Helps accelerates skins natural cell renewal to speed fresh skin cells to the surface Helps shed dull surface skin to visibly reduce wrinklesHyaluronic acid concentrate Instantly hydrates and plumps skin Helps restores suppleness and volume to diminish the appearance of fine dry linesResearch ResultsClinical TestingAs effective as one laser treatment on the look of lines and wrinkles after 16 weeksIn a clinical study after 16 weeks women who had one laser treatment showed the same improvement in the overall look of lines and wrinkles as those who used Smart Serum twice daily instead Laser used microablative deka dot SmartSkin CO2 Cynosure Westford MA with CO2 fractional techAlso in 10 days84 say deeper wrinkles look reduced94 say skin feels smoother87 say skin feels more plumped92 agree its gentle and nonirritatingConsumer testing on 358 women Clinique Smart Clinical Repair Wrinkle Correcting Serum
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333101698
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 26 $ : it belongs to the Face Care category; this product is sold by Clinique.com and made by Clinique.
Cliniques most advanced antiaging serum with 95 peptides and 1 advanced retinoid Helps reduce the look of wrinkles visibly lift smooth firm and boost radiance 100 show visibly reduced lines and wrinkles Dermatologist developed and tested Safe for sensitive skin Allergy tested 100 fragrance free Clinique Smart Clinical Repair trade Wrinkle Correcting Serum 033oz10ml
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Smart Clinical Repair Overnight sold for 80 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Smart Clinical Repair Overnight Recovery Face Cream Mask SMRT CLNCL RPR VRNT RCVRY CRM MSKBenefitsHelps restore your skin barrier which is naturally weaker at night A weaker barrier makes skin more susceptible to external factors which makes it more prone to sensitivityOptimizes skins natural nightly repair process visibly reducing lines and wrinkles and soothing the look of sensitivityPlumps and reduces fine dry lines overnightVisibly corrects wrinkles smooths skin and boosts radiance over timeDelivers rich deep hydrationDermatologist tested Safe for sensitive skinAllergy tested 100 fragrance freeKey IngredientsAdenosine Naturally occurring nocturnal biomolecule helps visibly quell irritation turning down or soothing sensitivityPeptides Help boost skins strength for a smoother appearance Formula includes neuropeptide and signaling peptides Palmitoyl tripeptide1 Acetyl hexapeptide8 Palmitoyl tetrapeptide712 hyaluronic acid solution Helps hydrate to visibly smooth fine dry linesResearch ResultsOvernightSkin is hydrated feels soothed and skin barrier is strengthenedIn 1 weekCrows feet forehead lines nasolabial folds and neck lines are visibly reducedIn 2 weeks97 show reduced facial lines92 say skin looks healthier94 say skin looks smoother92 say skin looks radiantClinical testing on 33 women after using the product for 1 weekFacial lines refers to crows feet lines Clinical testing on 33 women after using the product for 2 weeksConsumer testing on 132 women after using the product for 2 weeks Smart Clinical Repair Overnight Recovery Face Cream Mask
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333232392
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 77 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
