Discover information, advice, and prices for Dermalogica Super Rich Repair 1, priced at 94 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Dermalogica.
Super Rich Repair Moisturizer SUPER RICH REPAIR 17OZBenefitsDeeply nourishing treatment that delivers immediate benefits to chronically dry dehydrated and inflamed skinThis concentrated ultrathick cream is formulated with vegan peptides that stimulate collagen production while an acidfree renewal complex smooths fine lines for dramatically improved elasticity and toneWhipped shea butter and oil of evening primrose replenish skin with maximum hydration relieving dryness and reinforcing skins natural defense barrierKey IngredientsAllantoin Provides antiinflammatory and antiaging benefitsShea Butter Rich in Vitamins and fatty acids to hydrate and softenJojoba Oil Moisturizes without clogging poresFormulated WithoutParabensSulfatesPhthalatesSynthetic FragranceDermalogica Super Rich Repair 17oz
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0666151030978
Explore tips, opinions, and features on Dermalogica 1 7oz Super Rich sold at 89.99 $ ; this product is listed in the Face Care category, produced by Dermalogica, and sold by Gilt.com.
About the brand Cleansers masks treatments and more for skin at any age 17oz Super Rich Repair Deeply nourishing skin treatment cream combats chronically dry dehydrated skin Ingredients Simmondsia chinensis jojoba seed oil butyrospermum parkii shea butter avena sativa oat kernel extract pyrus malus apple seed extract and borago officinalis seed oil Made in the USA
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Dermalogica Unisex 1oz Barrier Repair sold for 45.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Dermalogica.
About the brand Cleansers masks treatments and more for skin at any age Creates a smooth even base on skin making it a great makeup prep Reinforces skins lipid barrier layer This product has not been tested on animals Apply a small amount evenly over face and throat with light upward strokes Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Wrinklefighting cream helps strengthen and nourish for smoother youngerlooking skin Please Note 15ml size is excluded from additional discounts Clinique Smart Clinical Repair trade Wrinkle Correcting Rich Cream 17oz50ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Lux Japan Super Rich Shine, priced at 31.7 $ : it belongs to the Make up category; this product is sold by Yesstyle.com and made by Lux Japan.
Brand from Japan Lux Japan Contains ingredients for daily care of damaged hairHighly adheres to the hair The treatment spreads smoothly on the hair and the repairing moisturizing ingredients stay in the hair for a long time making the hair soft all the way to the endsHow to useAfter shampooing and conditioning lightly drain the water apply an appropriate amount about 2 large muscat grains for semilong hair to the entire hair focusing on the ends and rinse offEven if you rinse it immediately you can take good care of itRecommended for daily use
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 4902111771946
Find tips, reviews, and features on Clinique Women s 1 7oz sold for 59.99 $ , available in the Face Care category; this product belongs to Clinique and is sold by Gilt.com.
Smart Clinical Repair Wrinkle Correcting Rich Cream 17oz Suitable for very dry to dry dry combination Use twice a day morning and night Apply to face and neck after using Clinique Smart Clinical Repair Wrinkle Correcting Serum Ingredients WaterAquaEau Butyrospermum Parkii Shea Butter Butylene Glycol Cetearyl Alcohol Glycerin Phenyl Trimethicone Hydrogenated Polyisobutene Sucrose Peg100 Stearate Cetyl Esters Polyglyceryl3 Beeswax HdiTrimethylol Hexyllactone Crosspolymer Isostearyl Neopentanoate Cetearyl Glucoside Palmitoyl Tetrapeptide7 Algae Extract Sodium Hyaluronate Palmitoyl Hexapeptide12 Sigesbeckia Orientalis St PaulS Wort Extract Whey ProteinLactis ProteinProteine Du PetitLait Dipeptide Diaminobutyroyl Benzylamide Diacetate Glycine Soja Soybean Seed Extract Caffeine Acetyl Glucosamine Linoleic Acid Aminopropyl Ascorbyl Phosphate Dimethicone Polybutene Caprylyl Glycol Acetyl Hexapeptide8 Palmitoyl Tripeptide1 Acetyl Octapeptide3 Methyl Glucose Sesquistearate Peg8 Polymethyl Methacrylate Polysilicone11 Glyceryl Polymethacrylate Stearic Acid 12Hexanediol Carbomer Silica Polysorbate 20 Aminomethyl Propanol Disodium Edta Sodium Citrate Tocopheryl Acetate Bht Phenoxyethanol Sodium Dehydroacetate Potassium Sorbate This product is not tested on animals This product is parabenfree Made in Canada All items for external use only
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on VEVOR 1 2 Drive Impact sold at 80.99 $ ; this product is listed in the Hand Tools category, produced by VEVOR, and sold by Vevor.com.
VEVOR 12 Drive Impact Socket Set 65 Piece Socket Set SAE 38 to 114 and Metric 1024mm 6 Point CrV Alloy Steel for Auto Repair Rugged Construction EasytoRead Size Markings Storage CaseRugged and DurableComplete SpecificationsWithstand High TorqueDistinct Size MarkingsHeavyDuty Carrying CaseBlack Phosphating TreatmentImpact Sockets Set 65 PiecesItem Model Number SS213878655Material CrV Alloy SteelHardness HRC4248Net Weight 3285 lbs 149 kgProduct Size 2106 x 1685 x 268 in 535 x 428 x 68 mm
Condition: new
Disponibility: in_stock
Delivery Time: 2~5 days
EAN: 0840349938493
Explore tips, opinions, and features on VEVOR 1 2 Drive Impact sold at 52.99 $ ; this product is listed in the Hand Tools category, produced by VEVOR, and sold by Vevor.com.
VEVOR 12 Drive Impact Socket Set 33 Piece Socket Set SAE 381 and Metric 1024mm 6 Point CrV Alloy Steel for Auto Repair EasytoRead Size Markings Rugged Construction Includes Storage CaseRugged and DurableComplete SpecificationsWithstand High TorqueDistinct Size MarkingsHeavyDuty Carrying CaseBlack Phosphating TreatmentImpact Sockets Set 33 PiecesItem Model Number SS21387833Material CrV Alloy SteelHardness HRC4248Net Weight 1984 lbs 9 kgProduct Size 2028 x 1299 x 256 in 515 x 330 x 65 mm
Condition: new
Disponibility: in_stock
Delivery Time: 2~5 days
EAN: 0840349938509
Discover information, advice, and prices for Neutrogena Intense Repair Rich Balm, priced at 29.2 $ : it belongs to the Body Care category; this product is sold by Yesstyle.com and made by Neutrogena.
Brand from United States Neutrogena CICA ingredient Centella asiatica extract penetrates into the stratum corneum and smooths out the dead skinHighly moisturizing glycerin provides moisture to rough areas leading to soft skinFragrancefree coloringfree parabenfreeCan be used on the face body and any other parts that are prone to drynessHow to useTake an appropriate amount and use it especially on your face and body where you are concerned about dryness
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 4901730200080
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product belongs to Clinique and is sold by Ulta.com.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
Discover information, advice, and prices for Dermalogica 5 1oz PreCleanse Cleanser sold for 45.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Dermalogica.
About the brand Cleansers masks treatments and more for skin at any age Deepcleansing oil melts impurities and makeup from skin Removes oils without clogging pores Achieve ultra clean and healthy skin with a double cleansing regimen This product has not been tested on animals Dispense into dry hands Massage over dry face and eyes to dissolve surface oil and dirt Concentrate on areas of congestion or stubborn debris Wet hands and continue massaging to create a light milky emulsion Rinse with lukewarm water Follow with prescribed Dermalogica Cleanser for professional cleansing results Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
EAN: 0666151010628
Find tips, reviews, and features on Briogeo Don t Despair Repair sold for 47.99 $ , available in the Hair Care category; this product belongs to Briogeo and is sold by Thedetoxmarket.com.
Rich Rice Shampoo Concentrate is a wateractivated treatment shampoo infused with the optimal balance of rice protein moisture to replenish severely damaged hair Our unique formula is 3x more concentrated than traditional shampoos and is sustainably packaged in a fully recyclable aluminum tube
Condition: new
Disponibility: in_stock
Shipping: 5.99
Delivery Time: 2-7 business days
EAN: 0793888589636
Discover information, advice, and prices for Dermalogica Biolumin C Vitamin Gel, priced at 69 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Dermalogica.
BioluminC Vitamin C Gel Moisturizer BIOLUMIN C VITAMIN C MOISTURIZER 17OZBenefitsProvides weightless hydrationGives skin a radiance boostBrightens the appearance of skin immediately and over timeKey IngredientsHighlystable Vitamin C complex helps boost bioavailability for brighter skin and improved barrier defenseSqualane and Hyaluronic Acid deliver essential hydration to minimize the appearance of fine lines and wrinklesBioluminescence Flower Extract provides an instant brightening effectPhytic Acid and Pumpkin Enzymes with exfoliating properties support natural skin renewalResearch ResultsAfter 4 weeks participants hadBrighter more radiant skina more even skin tonevisibly reduced fine lines wrinklesclinical test 35 subjects 2 applicationsday 4 weeks Results may vary BioluminC Vitamin C Gel Moisturizer
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0666151112346
Discover information, advice, and prices for Dermalogica 5 1oz Antioxidant HydraMist sold for 39.99 $ , available in the Face Care category; this product is sold by Gilt.com and made by Dermalogica.
About the brand Cleansers masks treatments and more for skin at any age 51oz Antioxidant HydraMist 51 FL OZ A refreshing peptide toner that creates a hydrating antioxidant shield over skin to help reduce fine dryness lines and prevent the signs of aging Ingredients Hydrogenated castor oil camellia sinensis leaf extract bambusa vulgaris leafstem extract pisum sativum pea extract citrus medica limonum lemon peel extract helianthus annuus sunflower seed oil rose damascena flower oil eugenia caryophyllus clove flower oil aniba rosaeodora rosewood wood oil citrus medica limonum lemon peel oil pelargonium graveolens oil Made in the USA
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Dermalogica PreCleanse 5 1oz Size sold for 49 $ , available in the Face Care category; this product is sold by Ulta.com and made by Dermalogica.
PreCleanse Cleansing Oil PRE CLEANSE 51OZBenefitsMelt away makeup sunscreen and daily pollution buildup with the Double Cleanse regimen that begins with Precleanse a Dermalogica Best SellerThis plantbased vegan cleansing oil is lightweight and formulated with a blend of nourishing olive and kukui oils to purify pores and deep clean residual products that build up on skin throughout the dayGreat for all skin types and can be used around the eye area to wash away even the toughest waterproof mascara without leaving a residueRemoves oil without clogging pores and nourishes skinSafe for use around the eye areaEnables your cleanser to work more efficientlyComplete your Double Cleanse regimen with Dermalogicas Special Cleansing Gel to help you achieve ultrasqueakyclean skinKey IngredientsVitamin E Nourishes and protects skin from damageRice Bran Rich in oryzanol which is high in antioxidants and packed with B Vitamins to soften skinKukui Nut Abundant source of Vitamin A Vitamin C Vitamin E and omega 3 fatty acids that reinforce the protective skin barrierDermalogica PreCleanse 51oz
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0666151010628
Explore tips, opinions, and features on Olay Travel Size Super Serum sold at 31.94 $ ; this product is listed in the Face Care category, produced by Olay, and sold by Ulta.com.
Travel Size Super Serum Night Repair 5in1 Face Serum SUPER SERUM NIGHT 04OZBenefitsLightweight Formula doesnt leave behind a sticky or tacky feelingOvernight Deep Moisture get hydration instantlyMore Even Skin Tone use daily for better skin texture and more even tone in just two weeksHealthierLooking Skin smooth visible lines in just one monthKey IngredientsSalicylic AcidNiacinamideLactic AcidPeptide Travel Size Super Serum Night Repair 5in1 Face Serum
Condition: new
Disponibility: in_stock
Shipping: 6.95
Delivery Time: 3-8 Business Days
EAN: 0075609209024
Find tips, reviews, and features on Olay Super Serum Night Repair sold for 43.99 $ , available in the Face Care category; this product belongs to Olay and is sold by Ulta.com.
Super Serum Night Repair 5in1 Face Serum SUPER SERUM NIGHT 10OZBenefitsLightweight Formula doesnt leave behind a sticky or tacky feelingOvernight Deep Moisture get hydration instantlyMore Even Skin Tone use daily for better skin texture and more even tone in just two weeksHealthierLooking Skin smooth visible lines in just one monthKey IngredientsSalicylic AcidNiacinamideLactic AcidPeptide Super Serum Night Repair 5in1 Face Serum
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0075609209000
Find tips, reviews, and features on Dermalogica Intensive Moisture Balance sold for 98 $ , available in the Face Care category; this product belongs to Dermalogica and is sold by Ulta.com.
Intensive Moisture Balance Moisturizer INTENSIVE MOISTURE BALANCE JUMBOBenefitsIntensely moisturizes dry depleted skinImproves skins texture using hyaluronic acid echinacea aloe vera and a prebiotic chlorella algae complexThis formula locks in hydration enhances moisture content improves firmness and reduces the appearance of fine linesRestores balance to dry skin to give a clean healthy appearanceSuggested for those concerned with fines line and wrinkles dryness dullness and uneven skin textureKey IngredientsHyaluronic Acid Hydrates the skinBioReplenish Complex Enhances skins natural resilience and barrierLactic Acid Hydrates and exfoliates the skinPrebiotic Chlorella Algae Complex Helps rebalance the skins natural microbiome for healthylooking skinAloe Vera Soothes the skinResearch ResultsClinically proven to deliver nourishment in the skin 10 layers deep Intensive Moisture Balance Moisturizer
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0666151113503
Discover information, advice, and prices for Dermalogica Active Moist 1 7oz sold for 48 $ , available in the Face Care category; this product is sold by Ulta.com and made by Dermalogica.
Active Moist OilFree Moisturizer ACTIVE MOIST 17OZBenefitsA sheer oilfree and lightweight face and neck moisturizer that contains a Prebiotic Moisture Complex and unique blend of plant extracts that weightlessly hydrate and help improve skin textureThis formula applies smoothly absorbs quickly actively balances skin hydration and will not clog pores or leave a greasy afterfeelRecommended for those with oily skin combination skin dryness dullness and uneven textureKey IngredientsOilFree Prebiotic Moisture Complex provides balanced and longlasting hydration to oily skin without a heavy greasy feelLemon and Burdock Extracts Help refine skins textureCucumber Extract Deeply hydrates and soothes skinFormulated WithoutParabensSulfatesPhthalatesSynthetic FragranceDermalogica Active Moist 17oz
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0666151030855
Find tips, reviews, and features on VEVOR Pipe Tube Bender 3 sold for 128.99 $ , available in the Hand Tools category; this product belongs to VEVOR and is sold by Vevor.com.
VEVOR Pipe Tube Bender 38 to 1 Manual Pipe Tube Bender with 7 Dies Heavy Duty Tube Bender Tubing of Steel Metal Copper for Repair Shops BlueMax 1 Pipe CapacitySeven 180 Degrees DiesHighQuality Carbon SteelErgonomic Long HandlePortable DesignWide ApplicationGross Weight 25 kg 551 lbsExternal Diameter of Half Circlemm 100119139159179225225Pipe Diameter Range 381Wall Thickness of Pipe 08 20 mmTotal Length w Handle on 86 cm 335Package Dimensions 2126 x 827 x 630Net Weight 23 kg 507 lbsBending Formers 38 12 916 58 34 78 1
Condition: new
Disponibility: in_stock
Delivery Time: 2~5 days
EAN: 0601707108602
