Explore tips, opinions, and features on THE RETINOTIME Wrinkle Lotion Rich sold at 57.6 $ ; this product is listed in the Face Care category, produced by THE RETINOTIME, and sold by Yesstyle.com.
Brand from Japan THE RETINOTIME The active ingredient niacinamide which has been shown to improve wrinkles approaches the epidermis and dermisImproves wrinkles on the eyes mouth folds cheeks etcContains keratin clear ingredientsGently removes the old keratin that causes the skin to become stiff and dull while smoothing the surface of the skinFragrancefree colorfree weakly acidic mineral oilfree parabenfreeHow to useAfter washing your face take an appropriate amount on cotton wipe it gently and then put it onAlternatively you can take an appropriate amount on your palm and apply it to your entire face
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 4955814704681
Discover information, advice, and prices for THE RETINOTIME Wrinkle Lotion Moist sold for 57.6 $ , available in the Body Care category; this product is sold by Yesstyle.com and made by THE RETINOTIME.
Brand from Japan THE RETINOTIME The active ingredient niacinamide which has been shown to improve wrinkles approaches the epidermis and dermis Improves wrinkles on the eyes mouth folds cheeks etcContains keratin clear ingredientsGently removes the old keratin that causes the skin to become stiff and dull while smoothing the surface of the skinFragrancefree colorfree weakly acidic mineral oilfree parabenfreeHow to useAt the beginning of use push the pump several times until the contents come outAfter washing your face take an appropriate amount on cotton wipe it gently and then put it onAlternatively you can take an appropriate amount on your palm and apply it to your entire face
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 4955814704674
Find tips, reviews, and features on THE RETINOTIME White Whitening Lotion sold for 51.1 $ , available in the Body Care category; this product belongs to THE RETINOTIME and is sold by Yesstyle.com.
Brand from Japan THE RETINOTIME Contains W active ingredients of vitamin C derivatives and niacinamideSuppresses the production of melanin prevents blemishes and freckles and leaves skin with a sense of transparencySkin cleaner ingredient combinationProtects your skin from damage such as drying caused by UV raysAqua emollient ingredient combinationIt penetrates deep into the stratum corneum and holds moisture leaving your skin bright and lustrousHow to useAt the beginning of use push the pump several times until the contents come outAfter washing your face or wiping off your face take an appropriate amount on cotton and gently put it on your entire faceAlternatively you can take an appropriate amount on your palm and apply it to your entire face
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 4955814716264
Find tips, reviews, and features on THE RETINOTIME White Clear Lotion sold for 48.5 $ , available in the Body Care category; this product belongs to THE RETINOTIME and is sold by Yesstyle.com.
Brand from Japan THE RETINOTIME Contains W active ingredients of vitamin C derivatives and niacinamideSuppresses the production of melanin prevents blemishes and freckles and leaves skin with a sense of transparencyKeratin flexibility combination Gently removes old dead skin that causes skin stiffness and dullnessFor fresh and smooth skinHow to useAt the beginning of use push the pump several times until the contents come outAfter washing your face take an appropriate amount on cotton and wipe it gently before use
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 4955814713973
Find tips, reviews, and features on THE RETINOTIME Wrinkle Lotion Moist sold for 46.9 $ , available in the Make up category; this product belongs to THE RETINOTIME and is sold by Yesstyle.com.
Brand from Japan THE RETINOTIME The active ingredient niacinamide which has been shown to improve wrinkles approaches the epidermis and dermisImproves wrinkles on the eyes mouth folds cheeks etcContains keratin clear ingredientsGently removes the old keratin that causes the skin to become stiff and dull while smoothing the surface of the skinFragrancefree colorfree weakly acidic mineral oilfree parabenfreeHow to useAfter washing your face take an appropriate amount on cotton wipe it gently and then put it onAlternatively you can take an appropriate amount on your palm and apply it to your entire face
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 4955814705305
Explore tips, opinions, and features on THE RETINOTIME White Whitening Lotion sold at 50.2 $ ; this product is listed in the Body Care category, produced by THE RETINOTIME, and sold by Yesstyle.com.
Brand from Japan THE RETINOTIME Contains W active ingredients of vitamin C derivatives and niacinamideSuppresses the production of melanin prevents blemishes and freckles and leaves skin with a sense of transparencySkin cleaner ingredient combinationProtects your skin from damage such as drying caused by UV raysAqua emollient ingredient combinationIt penetrates deep into the stratum corneum and holds moisture leaving your skin bright and lustrousHow to useAt the beginning of use push the pump several times until the contents come outAfter washing your face or wiping off your face take an appropriate amount on cotton and gently put it on your entire faceAlternatively you can take an appropriate amount on your palm and apply it to your entire face
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 4955814717674
Find tips, reviews, and features on THE RETINOTIME Wrinkle Power Serum sold for 96.4 $ , available in the Face Care category; this product belongs to THE RETINOTIME and is sold by Yesstyle.com.
Brand from Japan THE RETINOTIME The active ingredient niacinamide which has been shown to improve wrinkles approaches the epidermis and dermisImproves wrinkles on the eyes mouth folds cheeks etcHighconcentration retinol palmitate esterFragrancefree colorfree weakly acidic mineral oilfree parabenfreeHow to useAfter applying lotion take an appropriate amount on the palm and apply it to the entire faceIt is effective to gently pull it outward from the center of the face and gently apply it to the eyes and mouth with the pad of your finger
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 4955814704704
Find tips, reviews, and features on Clinique Smart Clinical Repair Wrinkle sold for 77 $ , available in the Face Care category; this product belongs to Clinique and is sold by Clinique.com.
Wrinklefighting cream helps strengthen and nourish for smoother youngerlooking skin Please Note 15ml size is excluded from additional discounts Clinique Smart Clinical Repair trade Wrinkle Correcting Rich Cream 17oz50ml
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Clinique Smart Clinical Repair Wrinkle, priced at 77 $ : it belongs to the Face Care category; this product is sold by Ulta.com and made by Clinique.
Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 433OZBenefitsStrengthens visibly repairs lines and wrinkles hydratesA powerful addition to Cliniques most advanced deaging line yet Clinique Smart Clinical Repair this ultranourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple youngerlooking skinCuttingedge formula with CL1870 Peptide Complex helps boost skins natural collagen to help fortify the dermal structure leaving skin feeling stronger and looking smootherMoisturizer plumps skin with lasting hydrationAvailable in two textures Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe denser cream for those with drier skinBuilt on Dermatological Science As a dermatologistguided brand Cliniques commitment to safety starts with skincare science Clinique partners with the best minds in dermatology and formulate for all skin types tones concerns in service of all skinFragrancefree Parabenfree Phthalatefree Oilfree Free of synthetic colorsMore Responsible Packaging50ml and 15ml jars each contain a minimum of 30 postconsumer recycled contentCarton is made from responsibly sourced paperboard Please recycleKey IngredientsFormulated with peptides to help boost skins strength for a smoother appearance and hyaluronic acid to help hydrate skinCL1870 Peptide Complex An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen which helps strengthen skins natural support structureHyaluronic acid Exclusive formula uses two molecular weights of hyaluronic acid This intense humectant helps flood your skin with hydration and holds on Helps restore suppleness and visibly smooth fine dry linesSoybean seed extract An ingredient rich in lysophosphatidic acid LPA which nourishes to help fortify skinShea butter Found in the Rich Cream it contains lipids that form skins barrier and is integral to keeping drier skin hydrated Clinique Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 0192333125113
Discover information, advice, and prices for Clinique Women s 1 7oz, priced at 59.99 $ : it belongs to the Face Care category; this product is sold by Gilt.com and made by Clinique.
Smart Clinical Repair Wrinkle Correcting Rich Cream 17oz Suitable for very dry to dry dry combination Use twice a day morning and night Apply to face and neck after using Clinique Smart Clinical Repair Wrinkle Correcting Serum Ingredients WaterAquaEau Butyrospermum Parkii Shea Butter Butylene Glycol Cetearyl Alcohol Glycerin Phenyl Trimethicone Hydrogenated Polyisobutene Sucrose Peg100 Stearate Cetyl Esters Polyglyceryl3 Beeswax HdiTrimethylol Hexyllactone Crosspolymer Isostearyl Neopentanoate Cetearyl Glucoside Palmitoyl Tetrapeptide7 Algae Extract Sodium Hyaluronate Palmitoyl Hexapeptide12 Sigesbeckia Orientalis St PaulS Wort Extract Whey ProteinLactis ProteinProteine Du PetitLait Dipeptide Diaminobutyroyl Benzylamide Diacetate Glycine Soja Soybean Seed Extract Caffeine Acetyl Glucosamine Linoleic Acid Aminopropyl Ascorbyl Phosphate Dimethicone Polybutene Caprylyl Glycol Acetyl Hexapeptide8 Palmitoyl Tripeptide1 Acetyl Octapeptide3 Methyl Glucose Sesquistearate Peg8 Polymethyl Methacrylate Polysilicone11 Glyceryl Polymethacrylate Stearic Acid 12Hexanediol Carbomer Silica Polysorbate 20 Aminomethyl Propanol Disodium Edta Sodium Citrate Tocopheryl Acetate Bht Phenoxyethanol Sodium Dehydroacetate Potassium Sorbate This product is not tested on animals This product is parabenfree Made in Canada All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Cosmetex Roland Loshi Premium Gold, priced at 46.9 $ : it belongs to the Body Care category; this product is sold by Yesstyle.com and made by Roland.
Brand from Japan Cosmetex Roland This is an esthetic care lotion containing pure gold foil luxuryThe lotion conditions the skin which is out of balance due to drying
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 4936201102679
Discover information, advice, and prices for COSM PROUD Gold Amber Rich, priced at 105.7 $ : it belongs to the Body Care category; this product is sold by Yesstyle.com and made by COSMÉ PROUD.
Brand from Japan COSMÉ PROUD Amber and nanogold have combined their powers to deliver magnificent ingredients into the deepest layers of the skin Transcending 50 million years in time its mystical powers come back to life now in your skinAmber a jewel that holds the key to antiaging skincare is formed of the wondrous crystallization of resin that was secreted from the lush resources of the forests and subsequently underwent millennia of deep sleep The droplets from these trees having incorporated and stored within themselves such organic energy sources of the earth as carbon hydrogen and oxygen are able to generate unparalleled healing properties and by penetrating deep into your skin to enrich and moisturize itAmber results from the fossilization of resin in the pine trees that grew in the forests tens of thousands of years ago Amber is not only a beautiful jewel but has tremendous capacity to beautify human skin Whenever the prehistoric plants and insects sealed into amber r
Condition: new
Disponibility: in_stock
Delivery Time: 10-14 days
EAN: 4573132790096
Explore tips, opinions, and features on Sosu Migaki CL Lotion Plus sold at 31.1 $ ; this product is listed in the Body Care category, produced by Sosu, and sold by Yesstyle.com.
Brand from Japan Sosu Migaki CL Lotion Plus Rich Facial Moisturizing Lotion 200ml
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 4582174740815
Discover information, advice, and prices for Sosu Migaki Lotion Plus Rich, priced at 31.1 $ : it belongs to the Face Care category; this product is sold by Yesstyle.com and made by Sosu.
Brand from Japan Sosu Luxury lotion for daily use that is moist and moisturizedMoisturizing cosmetic that penetrates quickly and fills the stratum corneumVCGives the skin gloss and transparencyPLFor aging care care according to age
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
Find tips, reviews, and features on L Occitane LOCCITANE Unisex 8 sold for 29.99 $ , available in the Body Care category; this product belongs to L'Occitane and is sold by Gilt.com.
Shea Butter Rich Body Lotion 84oz A creamy lotion helps nourish moisturize and protect skin This lightweight nongreasy and rapidly absorbed by skin It revitalizes skin with multivitamins A B C and E Active ingredients Butyrospermum Parkii Sheau Butter Helianthus Annuus Sunflower Seed Oil Glycerin CocoCaprylateCaprate Olus OilVegetable Oil Polyglyceryl6 DisteauRate Cetyl Palmitate Calendula Officinalis Flower Extract Linum Usitatissimum Linseed Seed Extract Mel ExtractHoney Extract Althaeau Officinalis Root Extract Prunus Amygdalus Dulcis Sweet Almond Fruit Extract Jojoba Esters Made in France All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for THE RETINOTIME Wrinkle Day Milk, priced at 47 $ : it belongs to the Face Care category; this product is sold by Yesstyle.com and made by THE RETINOTIME.
Brand from Japan THE RETINOTIME
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 4955814717582
Discover information, advice, and prices for L Occitane Shea Butter Ultra, priced at 39.99 $ : it belongs to the Body Care category; this product is sold by Gilt.com and made by L'Occitane.
Shea Butter Ultra Rich Lip Balm Body Lotion Kit An ultrarich moisturizing lip balm Enriched with fair trade Shea Butter to moisturize and protect dry lips Offers healing and regenerating benefits The rich texture of the Shea Butter Ultra Rich Body Lotion is absorbed quickly to moisturize skin up to 24 hours Helps soothe skin especially after sun exposure or waxing Active Ingredients Octyldodecanol C1018 Triglycerides Butyrospermum Parkii Shea Butter Hydrogenated Castor Oil Euphorbia Cerifera Candelilla Wax Hydrogenated CocoGlycerides Cera AlbaBeeswax C1836 Acid Glycol Ester C1836 Acid Triglyceride Simmondsia Chinensis Jojoba Seed Oil Sucrose Tetrastearate Triacetate Tocopheryl Acetate ParfumFragrance Benzyl Benzoate AlphaIsomethyl Ionone Active Ingredients Water Butyrospermum Parkii Shea Butter Glycerin CaprylicCapric Triglyceride Vitis Vinifera Grape Seed Oil Dicaprylyl Carbonate Dimethicone Prunus Armeniaca Apricot Kernel Oil Cetearyl Alcohol Glyceryl Stearate Cocos Nucifera Coconut Oil Prunus Amygdalus Dulcis Sweet Almond Fruit Extract Mel ExtractHoney Extract Hydroxyethyl AcrylateSodium Acryloyldimethyl Taurate Copolymer Tocopherol Ethylhexylglycerin ParfumFragrance Xanthan Gum Propylene Glycol Sorbitan Isostearate Polysorbate 60 Chlorphenesin Peg100 Stearate Phenoxyethanol Ceteareth33 Benzyl Alcohol Benzyl Benzoate Hydroxyisohexyl 3Cyclohexene Carboxaldehyde Linalool Citronellol Butylphenyl Methylpropional Coumarin Hexyl Cinnamal Limonene Geraniol This product is not tested on animals Made in France All items for external use only Contents of set 039oz Lip Balm 84oz Body Lotion
Condition: new
Disponibility: in_stock
Explore tips, opinions, and features on Peter Thomas Roth 8oz Mega sold at 29.99 $ ; this product is listed in the Face Care category, produced by Roth, and sold by Gilt.com.
MegaRich Body Lotion Pack of 2 8oz An ultra effective body lotion that helps to instantly soothe and nourish the look of dehydrated skin Active ingredients WaterAquaEau Cetearyl Alcohol Glycerin Glyceryl Stearate CaprylicCapric Triglycerides Stearic Acid Isopropyl Myristate Ascorbic Acid Tocopheryl Acetate Panthenol Butyrospermum Parkii Shea Butter Butter Dimethicone Bht Cetearyl Ethylhexanoate Ppg3 Myristyl Ether Pinus Sylvestris Cone Extract Citrus Medica Limonum Lemon Fruit Extract Anthemis Nobilis Chamomile Flower Extract Humulus Lupulus Hops Extract This product is not tested on animals Made in the USA All items for external use only
Condition: new
Disponibility: in_stock
Discover information, advice, and prices for Kose Lecheri Wrinkle Repair Lotion sold for 46.88 $ , available in the Body Care category; this product is sold by Yesstyle.com and made by Kose.
Brand from Japan Kose Moisturizes deeply and lasts as if steamedHow to useAfter washing your face take an amount about the size of a 500yen coin on your palm or cotton and gently apply it to your skin
Condition: new
Disponibility: in_stock
Shipping: 6
Delivery Time: 10-14 days
EAN: 4971710283839
Find tips, reviews, and features on BLEU DE CHANEL After Shave sold for 75 $ , available in the After- shaves category; this product belongs to Chanel and is sold by Ulta.com.
BLEU DE CHANEL After Shave Lotion BLEU AFTERSHAVE LOTION 2020 34OZCompositionThe innovative waterlike formula combines the invigorating freshness of citrus with the strength of an aromatic accord complemented by rich woody and amber notesFragrance FamilyFreshKey NotesCitrusAmber Cedar BLEU DE CHANEL After Shave Lotion
Condition: new
Disponibility: in_stock
Delivery Time: 3-8 Business Days
EAN: 3145891070705